(data stored in ACNUC7421 zone)

EMBL: AM286690.PE134

AM286690.PE134       Location/Qualifiers
FT   CDS_pept        145289..145837
FT                   /transl_table=11
FT                   /locus_tag="ABO_0134"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /function="Putative translation factor, this domain has
FT                   been shown to preferentially bind to dsRNA"
FT                   /note="identified by match to TIGR protein family
FT                   HMMTIGR00057 InterPro: Sua5/YciO/YrdC/YwlC protein family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15582"
FT                   /db_xref="GOA:Q0VTD8"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VTD8"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR00057"
FT                   /protein_id="CAL15582.1"
FT                   /translation="MNQHLLSAAQIIQEGGVVAYPTESVYGLGCDPFNRNAVMQLLAIK
FT                   HRPVSKGLILIGESLAQLAPYLHLNEQQSAQLEKKWPAPITYLVDASDRLPAWVRGEHR
FT                   KVAVRVPDHPLARQLCQLAGQPIISTSANISGRPAARNRYQVARQLGNQLDFIVSGACD
FT                   RAAKPSTIIDLESGRILRP"
     atgaatcagc atctgctcag tgcggcacag atcattcagg aaggcggcgt tgtggcctat        60
     cctaccgagt ccgtttatgg tctgggctgc gaccctttta accgaaacgc ggttatgcag       120
     ttgctagcca tcaaacatcg gccggtgagc aaagggctga ttctgattgg tgagagcttg       180
     gcgcagttgg cgccgtattt gcacctgaac gaacagcaat cggctcagtt ggagaaaaaa       240
     tggccggctc cgataacgta cctggttgat gctagtgatc gcttgcctgc ctgggtgcga       300
     ggggagcacc gtaaggtggc ggtgcgggtg ccggaccacc cgctggcgcg gcagttatgc       360
     cagctggccg gtcagccgat catttccacc agtgccaaca tcagtggccg cccggcagcg       420
     cgtaatcgtt atcaggtggc tcgccagctg ggtaaccagc tcgactttat tgtcagtggt       480
     gcctgtgacc gggcagccaa accctctacc attattgact tggaaagtgg gcgcatcttg       540
     cgaccatga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page