(data stored in ACNUC7421 zone)

EMBL: AM286690.PE139

AM286690.PE139       Location/Qualifiers
FT   CDS_pept        complement(149202..149741)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0139"
FT                   /product="anhydrase, family 3 protein"
FT                   /note="identified by sequencesimilarity; putative InterPro:
FT                   Bacterial transferase hexapeptide repeat"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15587"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTD3"
FT                   /protein_id="CAL15587.1"
FT                   /translation="MMGIRRFEDKAPQLGKRVFVDEDATVIGEVILGDDCSVWPKAVIR
FT                   GDMHAIRIGNRVSIQDNAVLHITHDSPFNPGGFGLQVGDDVTLAHQAMLHGCTLGNRVM
FT                   VGMQAIIMDGAIVEDDVIVAAGSLVGPGKNLESGHLYRGQPARKIRPLTEKEKTFLPYV
FT                   AGNYVRLKDRYLKSSQ"
     gtgatgggga ttcgccgctt tgaagacaag gccccgcagt tggggaaacg ggtatttgta        60
     gatgaggacg ccaccgtgat tggcgaggtc atactgggcg acgattgttc ggtgtggccc       120
     aaggctgtga ttcggggcga catgcacgct attcgtatcg gtaaccgggt cagcattcag       180
     gataacgctg tactacacat cactcacgac tccccgttca atcccggcgg cttcgggctg       240
     caggtcggcg acgatgtcac cctggctcac caagccatgt tgcacggctg caccctcggc       300
     aaccgggtca tggtgggtat gcaggcaatc attatggacg gtgctattgt ggaagacgat       360
     gtgattgtcg ccgccggctc attggttggg cccggcaaaa accttgaaag cggccacctg       420
     tatcgcggcc aacccgcgcg caaaatccgt ccgctcaccg agaaagaaaa aacctttttg       480
     ccttatgtgg cgggtaatta tgtgcgcttg aaagatcgat atttgaaaag cagccaataa       540
//

If you have problems or comments...

PBIL Back to PBIL home page