(data stored in ACNUC7421 zone)

EMBL: AM286690.PE14

AM286690.PE14        Location/Qualifiers
FT   CDS_pept        16498..17004
FT                   /transl_table=11
FT                   /locus_tag="ABO_0014"
FT                   /product="transcriptional regulator, MarR family"
FT                   /function="regulation of transcription, DNA-dependent"
FT                   /note="transcriptional regulator MarR family identified by
FT                   sequencesimilarity; putative InterPro: Bacterial regulatory
FT                   protein MarR family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15462"
FT                   /db_xref="GOA:Q0VT17"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT17"
FT                   /protein_id="CAL15462.1"
FT                   /translation="MTRFDATENRISLTHKRFPAYPREPAMLVRLMKAISQHVHDSANV
FT                   LLREYGLNHTDYNVLMMLYGCEQQGMTVTQLRDAAAEKSANVTRVCNILCERGWIARFA
FT                   DPQDRRRVLVSLTTEGEKLVEQFLPSMASLLNQYGAAFDAQEIAVLETLLKRLLGVAEQ
FT                   IERNL"
     gtgacccgct tcgacgctac tgaaaatcgc attagcctga cccataagcg cttcccagcc        60
     taccctcgcg aaccagccat gctagtgcga ttgatgaaag ccatatccca gcatgtacat       120
     gactctgcca atgtgttgct gcgcgagtat gggcttaatc ataccgacta caatgtgttg       180
     atgatgctgt acggctgcga gcaacaaggg atgactgtca cccagctgcg cgatgcggcg       240
     gcggaaaagt ccgccaacgt gacccgagtg tgcaatattc tctgcgagcg ggggtggatc       300
     gctcgttttg cggaccctca ggaccggcgc cgagtgctgg tttccctgac cacggaagga       360
     gaaaagttgg tagaacagtt tctgccctcc atggcgtcct tgttaaacca gtacggggcc       420
     gcatttgatg cacaagaaat cgcggtactg gaaacgttgt tgaagcggtt actgggagtg       480
     gccgagcaga tcgaacggaa tctgtga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page