(data stored in ACNUC7421 zone)

EMBL: AM286690.PE149

AM286690.PE149       Location/Qualifiers
FT   CDS_pept        complement(159505..159921)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0149"
FT                   /product="conserved hypothetical protein"
FT                   /function="unkown"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15597"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTC3"
FT                   /protein_id="CAL15597.1"
FT                   /translation="MAEPLGLFPMIPNPNDTYLVYDGECPACRNYVRFIRFRNTIGPLH
FT                   LIDARQAPQWVAHMQEKGISLDDGMVLLLNGHYLHGADAVHHIALLSSPSGLFNCINAF
FT                   VFRSRKLSRCLYPVLKICRNTLLFLMGKKPLNTH"
     ttggctgagc ctcttggttt attccccatg atccccaatc caaacgacac ctatctggtt        60
     tacgatggcg aatgtcccgc ctgccgtaac tatgtgcgct ttatccgttt ccgtaacacg       120
     attgggccat tacatctaat tgatgcccgc caagcgccgc aatgggtagc ccatatgcag       180
     gaaaagggca tttccttgga tgacggcatg gtattactcc tcaacggtca ctatctccat       240
     ggcgccgatg cggtgcacca tatcgcctta ctcagcagcc caagcggcct atttaattgc       300
     attaatgctt ttgtgtttcg ctcccgcaag ctgtctcgtt gcctttatcc tgtgcttaaa       360
     atatgccgca acacactgct gtttcttatg gggaaaaagc cgctaaatac ccactaa          417
//

If you have problems or comments...

PBIL Back to PBIL home page