(data stored in ACNUC7421 zone)

EMBL: AM286690.PE150

AM286690.PE150       Location/Qualifiers
FT   CDS_pept        complement(159891..160814)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0150"
FT                   /product="hypothetical protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15598"
FT                   /db_xref="GOA:Q0VTC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTC2"
FT                   /protein_id="CAL15598.1"
FT                   /translation="MLNTDAINRRLSTTLTSPLLEKLCGREQQDFLAVVGALTLGILIF
FT                   HGFPHVYFAIPFQLLVISYLVWPALLRQGPFWFVVFLFSSAALWLNWTHADNHKYLLCY
FT                   WVFSLFLAFDNTIDRPAFLRRCARYLLFFTMMMAVVQKTLSPDYLSGDFFEFILMTDSR
FT                   FSALGSLVTGMDGDIFSENRQLYVRALDPLLADQPTATLHSSEALHRLALVITWVNYVD
FT                   QIAIAVMLLLPLSRRGEIFKHLLLMAFIIPVYAVAPVIGFGWLIIIWGYCLVPNDVAGL
FT                   RLGYLGLFLLLCIYEFPWLSLLVYSP"
     gtgttaaaca ctgacgccat caaccggcga ctgagcacca ccctcacgtc gccgctattg        60
     gaaaagttgt gtggccggga gcaacaggat tttcttgccg tcgttggggc tttaactctg       120
     ggcatcctga tttttcatgg ctttccccat gtctatttcg ccatcccttt ccaactgttg       180
     gtcatcagtt acctggtctg gccagcgcta ctgcgacaag gccccttctg gtttgtggtc       240
     tttttattca gctccgcagc cttatggttg aactggacac acgcggataa ccacaaatac       300
     ctgctttgtt actgggtatt cagtctgttt ctagcattcg acaacacgat tgatcggccc       360
     gcttttctaa ggcgctgtgc tcgttatctg cttttcttca ccatgatgat ggccgtggta       420
     cagaaaaccc tctctccgga ttacctaagt ggcgatttct ttgagtttat tctcatgaca       480
     gatagccgct ttagtgctct gggctcactg gtaacgggga tggatggcga tattttctct       540
     gaaaaccgcc aactttatgt acgggcacta gaccccttac ttgccgacca acccaccgcc       600
     acactgcaca gctctgaggc cttgcatcgc ttggcgttgg tgattacttg ggtcaactat       660
     gtagaccaaa ttgccattgc cgtcatgtta ctgcttccac tctcccggcg cggtgaaatt       720
     ttcaaacatc tgctgttgat ggcttttatc attcctgttt acgcagtagc tccggtcatc       780
     gggtttggct ggttgatcat catttgggga tattgtctgg tgcctaacga cgtggccggc       840
     ttaaggctag gctacttggg gttattcctg ttactttgta tctacgagtt tccttggctg       900
     agcctcttgg tttattcccc atga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page