(data stored in ACNUC7421 zone)

EMBL: AM286690.PE158

AM286690.PE158       Location/Qualifiers
FT   CDS_pept        166768..168057
FT                   /transl_table=11
FT                   /locus_tag="ABO_0158"
FT                   /product="MATE efflux family protein, putative"
FT                   /note="(MATE efflux family protein, putative) identified by
FT                   match to PFAM protein family HMMPF04235 InterPro:
FT                   Uncharacterized domain UPF0013"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15606"
FT                   /db_xref="GOA:Q0VTB4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTB4"
FT                   /inference="protein motif:HMMPFAM:HMMPF04235"
FT                   /protein_id="CAL15606.1"
FT                   /translation="MSVTLNQRIWMLAWPLLLSNLTAPLLGLMDTAVVGHLAHPRYLAA
FT                   VALGSNFFMFLYFSFNFLRMGTTGFASQAQGGKRDTRVVLLRGLLLSTLLGFALILLSP
FT                   LLRDAGLWLLGGSDAVQGLARDYINIRILGAPAALANFALIGFAIGTHNTRVPLKMTVL
FT                   MHSTNALLDILLVQVWNLDVRGVAIASACAEYVGLAGGLFWLRAALRPPAHRETVWQPV
FT                   AMWALMAVNRDIFIRSLALLTCFFFFTAQGARLGDATLAANAVLITFLLILSNLLDGFA
FT                   NAAEALVGEAQGRQDHQAFADAVAATGRWTIGCALVGLLGFCLGGAPLIGLLTDLPSIR
FT                   DTAIEYLPWVLLLPVTASAGFWLDGIFVGATWGTAMRNTMLASVGVFFMLWVCSRGWDN
FT                   HGLWLTMNGFMAARGVFMAWVLWGRRRHHA"
     atgagtgtga ccctcaacca acgtatctgg atgctggcct ggccgttgtt gttgtccaat        60
     ttgaccgccc cgttgctggg gcttatggat acggcggtgg taggccatct ggcgcatcct       120
     cgctacctgg cggcggtggc gttgggcagc aatttcttca tgttcttgta tttttcattc       180
     aacttcctgc gcatgggtac caccggcttt gcttctcaag cgcagggggg caagcgggac       240
     acccgtgtgg tgttactgcg tggcttgctg ctatcgaccc tgctcgggtt tgccctgatt       300
     ctgttgtcac cgctgctgcg cgatgcgggc ctgtggctac tgggcggcag tgatgcggtg       360
     caggggctgg cgcgggatta catcaacatc cgcattctcg gtgctcctgc cgcgctggcc       420
     aattttgccc ttattggctt tgccatcggc acccacaaca cccgcgtgcc cttaaaaatg       480
     acggtgttga tgcacagtac caatgcgttg ctggatatat tgctggtaca ggtctggaat       540
     ctggatgtcc gtggtgtggc cattgcgagc gcctgcgcag aatatgtggg cttggccggt       600
     ggtctgttct ggctgcgcgc tgccctgcga ccgcccgcgc atagggaaac cgtgtggcag       660
     cctgtggcta tgtgggcact gatggccgtg aaccgggata tttttattcg tagcttggcg       720
     ctgctgacgt gtttcttttt cttcaccgcc caaggcgcac ggctcggcga tgctacgcta       780
     gcggccaatg cggtactgat tacctttcta ctaatcctga gtaacctgct ggacgggttt       840
     gccaatgctg cggaagcgtt ggtgggggaa gctcagggca ggcaggatca ccaagccttt       900
     gcagacgccg tggcggctac cggccgctgg accatcggct gtgcgctggt gggcctgctg       960
     ggattctgct taggcggcgc accgttgatt ggtttactca ccgacctgcc atcgatccgt      1020
     gacacggcca tcgagtatct gccttgggta ttattgctgc ccgttaccgc tagcgccgga      1080
     ttttggttgg atgggatctt tgtcggcgcc acctggggta ccgccatgcg caacaccatg      1140
     ctggcgtcag tgggggtctt ctttatgctt tgggtatgct cccgtggctg ggataaccat      1200
     ggcctgtggt taaccatgaa tggcttcatg gcagcccggg gagtattcat ggcctgggtg      1260
     ttatggggtc gacgtcgcca tcatgcatga                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page