(data stored in ACNUC7421 zone)

EMBL: AM286690.PE161

AM286690.PE161       Location/Qualifiers
FT   CDS_pept        complement(170133..170570)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15609"
FT                   /db_xref="GOA:Q0VTB1"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTB1"
FT                   /protein_id="CAL15609.1"
FT                   /translation="MHGLFPYCNLTLAPDRQGFLMKFALVLLVLGWRLRWLAWRNTGFQ
FT                   KQLENRNVVMQWRTFAGKPARSFHFMPGKVVSKAGIHGKPTVTLNFKDAGYAFRTLQEA
FT                   GKNQMAFMEGMQAGNIKIEGDPGQLMWFMTLMKFIMPGGKK"
     ttgcatggcc tatttccgta ttgcaatttg acgcttgccc ctgacagaca aggatttctc        60
     atgaaatttg cactggtatt gctggttctt ggttggcggt tacgctggtt ggcgtggcgt       120
     aacacaggct ttcaaaagca gctggagaac cgcaatgtgg tgatgcagtg gcgcaccttc       180
     gcgggcaagc cggcgcgcag ttttcatttc atgccaggca aggtcgtgtc caaggcgggt       240
     attcacggca agcccacggt aaccctgaat ttcaaagacg caggctatgc cttccgcacc       300
     ttgcaggaag cgggcaaaaa ccagatggcg ttcatggaag gcatgcaggc cggtaatatc       360
     aagatcgaag gcgatccggg ccagcttatg tggtttatga ctttaatgaa attcatcatg       420
     cccggtggca aaaagtaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page