(data stored in ACNUC7421 zone)

EMBL: AM286690.PE176

AM286690.PE176       Location/Qualifiers
FT   CDS_pept        complement(184492..186603)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0176"
FT                   /product="GTP
FT                   pyrophosphokinase/Guanosine-3',5'-bis(Diphosphate)
FT                   3'-pyrophosphohydrolase"
FT                   /function="Guanosine polyphosphate pyrophosphohydrolases"
FT                   /EC_number="2.7.6.5"
FT                   /note="(relA) (GTP pyrophosphokinase) identified by match
FT                   to PFAM protein family HMMPF02824 InterPro: RelA/SpoT
FT                   family protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15624"
FT                   /db_xref="GOA:Q0VT96"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT96"
FT                   /inference="protein motif:HMMPFAM:HMMPF02824"
FT                   /protein_id="CAL15624.1"
FT                   /translation="MPTIHNLEKRLRSYLDDDQIAQVVHAYHFAEQAHEGQYRRTGDPY
FT                   ITHPLAVANILTDMHMDHASLMAAMLHDVIEDTGISKEQLANEFSEEVAELVDGVSKIA
FT                   QIKFESKAEQQAENLRKMMLAMTRDIRVILIKLADRLHNMRTLHVMRAEKRRRIATETL
FT                   ELYAPIAFRLGMYNMRVEYEDLAFHAIYPMRAKLIGQAVKKARGNRKEILSTIKTSLEH
FT                   CLEEEGIEARVLGREKHLFSIYCKMKEQHKPFVDIMDVFGFRIIVDRVDTCYRVLGAAH
FT                   NYFTPIPGRFKDYIAIPKANGYQSLHTTLKARSGIPLEMQIRTEEMEAMANNGIAAHWL
FT                   YKSDDEPGSPTHSRTQSWMQRLLELQQKTGNSMEFIENVKVDLFPDEAYVFTPKGDIKE
FT                   LPAGATAVDFAYAVHTKVGNKCVAARIDGKLAALSTPLESGQTVKIITAPSATPNPAWL
FT                   NFVVTGKARTNIRHFLKNQRREDAVELGQRLLEKALHSYEMGMDDLPIGRVVSELAGNG
FT                   YVELDGLLEDIGMGNRLAPLVARKLAGARDDDERQHEEDRRPLAIRGSEGLMVSYAKCC
FT                   CPLPGDTIIGHLSAGRGIVVHRDTCKNLLAEMRNSPEKCIALRWDKQVEQEFTATLRIE
FT                   LINKRGVLAILANSVSELGSNIDTIDMAEKDPTLTILNVTMTVKDRIHLARIIKKLRTL
FT                   DSIVRIHRL"
     ttgcccacca ttcataattt ggaaaaacgg ttacgtagtt atctggacga tgatcaaatc        60
     gcccaggtcg tacacgctta ccattttgcc gagcaagccc atgagggcca gtatcgtcgc       120
     accggcgacc cctacatcac ccatccactg gcagtcgcaa acatccttac cgacatgcac       180
     atggaccatg cctcgcttat ggcggccatg ctgcacgacg taatcgaaga cacaggcatc       240
     agcaaggagc agctggcaaa cgagttcagc gaggaagtgg ccgagctggt cgatggcgtt       300
     tccaaaatcg cccagatcaa gttcgaatcc aaggccgagc aacaggcaga aaacctgcgc       360
     aagatgatgc tggccatgac ccgggatatc cgcgttattc ttatcaagct ggccgaccgc       420
     ctgcacaaca tgcgcaccct gcatgtaatg cgcgcggaaa agcgtcgccg tatcgccacc       480
     gaaaccctag agctgtacgc ccccatcgcc ttccgcttgg gcatgtacaa catgcgggtt       540
     gaatacgaag acctggcctt tcacgccatc taccccatgc gagccaagct gattgggcag       600
     gctgttaaga aggctcgcgg caaccgcaag gaaatcctct ccaccatcaa gactagcctc       660
     gagcattgcc tagaagagga aggcatcgaa gcacgcgtgc tgggccgcga gaagcacctg       720
     ttcagcattt actgcaaaat gaaagagcag cacaaaccgt tcgtggatat catggatgtg       780
     ttcggttttc gtatcatcgt ggaccgggta gatacctgct accgcgtgct tggcgccgca       840
     cacaactact tcaccccgat tcctgggcgc tttaaagact atattgccat ccctaaggcc       900
     aatggctacc agtccctgca caccacgctg aaggctcgct ccgggatccc gctggaaatg       960
     cagattcgta ccgaggaaat ggaagccatg gctaacaatg gcatcgccgc ccattggctt      1020
     tacaagtccg atgacgagcc tggctcgccc acccacagcc gcacccagag ctggatgcaa      1080
     cggttacttg agctgcagca aaaaaccggc aattccatgg agttcatcga aaatgtgaag      1140
     gtggacctat tcccggacga agcctatgtg ttcaccccca agggggatat caaggaactg      1200
     cccgccggtg ccacagccgt ggacttcgcc tacgcggtgc acaccaaagt gggtaacaaa      1260
     tgcgtcgcag cacgtatcga tggcaagctt gccgctttgt ccacaccact ggagtccggg      1320
     cagaccgtca aaatcatcac cgcacccagc gccacgccaa acccagcatg gttgaacttc      1380
     gtagttactg gcaaggcacg caccaacatt cgccattttc tcaagaatca acgccgcgaa      1440
     gatgcggtcg agttgggcca acggctattg gaaaaagccc tgcattccta cgagatgggc      1500
     atggatgatt tgcctatcgg ccgcgtggtc agtgaactgg ccggtaacgg ttatgtggag      1560
     ctggatggcc tactagaaga tatcggcatg ggcaatcgcc tagcgccact ggtcgcgcgc      1620
     aaacttgccg gcgcccgcga tgacgacgaa cgccagcacg aagaggaccg acgcccacta      1680
     gccatccgcg gcagcgaagg cctgatggtc agctacgcga agtgttgctg ccctttaccc      1740
     ggcgacacca tcatcggcca ccttagcgcc gggcgcggca tcgtagtcca ccgtgacacc      1800
     tgcaaaaacc tgctggcgga aatgcgtaac tccccggaga aatgcattgc cttgcgttgg      1860
     gataaacagg tggaacagga attcactgcc accctgcgta tcgagctaat caacaagcgc      1920
     ggcgtgctcg ccatcctggc caacagcgtg tcggaactgg gttccaacat cgacaccatc      1980
     gacatggctg agaaagaccc caccctcacc attctcaatg tgaccatgac cgtaaaagat      2040
     cggatccacc tagcgcgcat catcaaaaaa ctacgcaccc tagacagcat agtaagaatt      2100
     caccggcttt aa                                                          2112
//

If you have problems or comments...

PBIL Back to PBIL home page