(data stored in ACNUC7421 zone)

EMBL: AM286690.PE18

AM286690.PE18        Location/Qualifiers
FT   CDS_pept        20469..21194
FT                   /transl_table=11
FT                   /locus_tag="ABO_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15466"
FT                   /db_xref="InterPro:IPR015315"
FT                   /db_xref="InterPro:IPR035948"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT13"
FT                   /protein_id="CAL15466.1"
FT                   /translation="MLPEEIKHKLAILSRPAWRPRVGPAVPGARSKFGGLPLLKKDEAW
FT                   PCCGHCHQPMQLFVQLDSLDLPVEARSAFGDGVLQVFYCTNGEEDCEVLGHAHLPFSDV
FT                   TLVRVIPRQQADGFDALPQAIPDAFVEQALTGWQCMTDFPDRQEMTAINDDVPEAMLAL
FT                   LQAHRPTPRPGDKFLGWPNWVSEVSYPLCSCCEKPMKFIFQLDSADTLPFWFGNSGCAY
FT                   VFQCESNPKVLTMSWISRP"
     atgttacccg aagaaatcaa acacaaattg gctattttgt cccgtcccgc ctggcgccct        60
     cgagtggggc cggcggtgcc aggtgcgcgc tccaaatttg gcggcctgcc gctgctgaaa       120
     aaggacgaag cttggccatg ctgcggccac tgccaccagc ctatgcagtt gtttgtgcag       180
     cttgattcgc tggatttgcc ggtcgaggcc cgcagcgcat tcggtgatgg tgtgttgcag       240
     gtgttttact gtactaacgg ggaggaagat tgcgaggtac tggggcatgc gcacctgcca       300
     ttctctgatg tcacgttggt gcgagtcatt ccccgccagc aagccgatgg ttttgatgcc       360
     ctaccgcaag ccattcccga tgcgtttgtt gagcaagcat tgactggctg gcagtgcatg       420
     acggattttc ccgaccggca ggaaatgact gcgattaatg atgatgttcc ggaagctatg       480
     ctcgccttac ttcaagctca ccgccctact ccgcgtccgg gtgacaagtt tctcggttgg       540
     cctaactggg taagcgaggt aagttaccca ctgtgttcct gttgcgaaaa accgatgaaa       600
     tttatttttc agctggactc cgcagacacc cttccatttt ggtttggtaa tagcggttgt       660
     gcctatgtat ttcagtgtga aagcaaccca aaggtattaa ctatgagttg gataagtcga       720
     ccatag                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page