(data stored in ACNUC7421 zone)

EMBL: AM286690.PE182

AM286690.PE182       Location/Qualifiers
FT   CDS_pept        191778..192758
FT                   /transl_table=11
FT                   /locus_tag="ABO_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15630"
FT                   /db_xref="InterPro:IPR026935"
FT                   /db_xref="InterPro:IPR032369"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT90"
FT                   /protein_id="CAL15630.1"
FT                   /translation="MSGAEYHKHTHRPGRHCGSSAIRDLLEFHGLNLTEAFCFGLGAGL
FT                   GITYVEIPNSDTPFIVHVRSMGFEEAVFSTLGVPFHWESWQDKEDAAKALDGYLDAGRP
FT                   ALLLTDIYHLPYFKSSTHFPGHAIVAWQRTDDGKTVLVSDTERPELLEVPRDKLALARF
FT                   SLTPPFIHHGSLFAPEDISVEISPEQVKSAIIRNAQTLKDGDKNQGIEALNTWINDLHR
FT                   WKDFEKWPWLLRFAYQVIEKRGTGGGGFRTMYAEFIDEAEEVIPALKKMGLSDLMRDSA
FT                   SAWSALADCLRLGSESETFPTEMIREAIAKVREAELRYIDAALTL"
     atgagtggcg ccgaatacca taagcacact cataggcctg gacgtcattg tggtagctca        60
     gccatcaggg atctgctcga atttcatggg cttaacctga ctgaggcttt ctgttttggc       120
     ctgggtgcgg ggcttggtat tacctatgtg gaaataccaa attctgatac gccttttatt       180
     gttcatgttc gctcaatggg ttttgaagag gcggtgttct caacactggg agtgccgttt       240
     cattgggaat cttggcagga taaagaggac gctgcgaagg cgctagatgg atatcttgat       300
     gctggtcgtc ctgctctctt gttaaccgat atatatcacc ttccttattt taaaagtagt       360
     acccatttcc ccggtcatgc aattgttgct tggcagcgga ctgatgatgg gaaaacggtt       420
     ttggtgagtg ataccgagcg gcctgagctt cttgaggtgc cgcgcgataa gctggcactg       480
     gcgcgctttt ctttgacgcc accttttatt catcacggct ctctgttcgc tccggaagat       540
     atctcagttg aaatctctcc cgagcaggtc aagagtgcga ttattcgtaa tgcgcaaacg       600
     cttaaagatg gtgataaaaa ccagggcatt gaagcactga atacttggat caatgatctt       660
     catcgctgga aagattttga aaaatggcct tggttgctgc gttttgcgta tcaagtgata       720
     gagaagcgcg gtactggcgg cggtggtttc cgcactatgt atgcagagtt tattgatgag       780
     gcagaggagg taatccccgc actcaaaaaa atgggcctgt ctgatttgat gcgcgactct       840
     gccagtgcgt ggtctgcatt ggctgattgt cttcgcttgg gttctgaaag tgagacgttt       900
     cctactgaga tgatccgtga agccatagcc aaggtgagag aagcagaatt gcggtatata       960
     gacgccgcgt tgacattatg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page