(data stored in ACNUC7421 zone)

EMBL: AM286690.PE188

AM286690.PE188       Location/Qualifiers
FT   CDS_pept        complement(200034..200918)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0188"
FT                   /product="predicted metal hydrolase, putative"
FT                   /note="predicted metal-dependent hydrolase"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15636"
FT                   /db_xref="GOA:Q0VT84"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT84"
FT                   /protein_id="CAL15636.1"
FT                   /translation="MRSSNPVKSIKKLSGALVGIPPRHINFSFPENMPKYFYAGNATAT
FT                   TFFAMLSGFFPPGERYFMESVRHFRNEVKDETLRAEISGFMGQEAIHGREHDRLNNILS
FT                   EYGFDMQAPDRFVKIGLAILEKLPPSTRLAATTFMEHFTALLAEQLLNDEQFVQQADPE
FT                   MIKIWQWHALEELEHKSVAYDVYELIGNSRIERAAAALASVVVLLPMLGVTWSWMLAKD
FT                   GQLGNLKDNIKGLNVLLGRNGFVSRILSRLPEFVEPNFHPNQHNTKQLESNWRDKLFAV
FT                   GGALHDQYSNSAA"
     atgcgctctt caaaccctgt caaaagcata aaaaaactca gcggagccct cgttggcatt        60
     ccgcctagac atattaattt tagtttccca gaaaatatgc cgaaatactt ctacgcagga       120
     aatgcaactg ccacgacatt tttcgcaatg ctttcgggat tttttccgcc gggcgaacga       180
     tacttcatgg aatcggtaag acactttcga aatgaagtta aagacgaaac tctgcgtgca       240
     gaaatttcag gatttatggg tcaggaagcc atccatggtc gcgaacatga ccgactcaac       300
     aacatccttt ctgagtacgg ctttgacatg caggccccgg accgtttcgt taaaattggc       360
     ctagccatac ttgaaaagtt acccccgagc acgcgacttg cggccacgac ttttatggag       420
     catttcactg cccttctagc cgaacagctc cttaacgatg aacaattcgt acagcaagct       480
     gaccctgaaa tgatcaagat atggcagtgg catgcacttg aagaacttga gcacaaatct       540
     gttgcttatg acgtttacga gctgatcggg aacagccgta tcgaaagagc cgccgcagca       600
     ctggcgtccg tagtagtatt gcttccgatg ctaggagtaa cttggagctg gatgctggca       660
     aaagacggcc agctaggtaa tttaaaagat aatatcaaag gtcttaacgt attattgggt       720
     cgcaatggtt ttgtatcacg catactatca aggcttcccg aattcgtaga accgaatttc       780
     caccccaatc aacacaatac caaacagctg gagagcaatt ggcgagataa gctatttgcc       840
     gtaggcggag cattgcatga tcaatatagc aattcagctg cctga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page