(data stored in ACNUC7421 zone)

EMBL: AM286690.PE189

AM286690.PE189       Location/Qualifiers
FT   CDS_pept        complement(200959..201825)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0189"
FT                   /product="short chain dehydrogenase, putative"
FT                   /EC_number="1.1.1.-"
FT                   /note="oxidoreductase short chaindehydrogenase/reductase
FT                   family identified by sequence similarity; putative
FT                   InterPro: Short-chain dehydrogenase/reductase (SDR)
FT                   superfamily"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15637"
FT                   /db_xref="GOA:Q0VT83"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT83"
FT                   /protein_id="CAL15637.1"
FT                   /translation="MKSFSGKVAAITGAGSGIGQATAIALAKKGCHLAISDISQESLEK
FT                   TIKMLAHYPVKVSSHVVDVSDREAVYKYADDTVTEHGKVNIIMNNAGVGLGETVENMSY
FT                   ENFEWLMNINFWGVVYGTKAFLPHLKRADEGHIINISSVFGIIGVPTQSAYNAAKFAVR
FT                   GFTESLREELDIEGGRVSATSVHPGGVKTNIARNSRMGDMGDMGIGDKEDIADMFEKIA
FT                   MTTPETAAKTILKAVRKNRRRVLVGGDAIMLDTTQRLMPTGYQRLLEVMFKKQQGKNSK
FT                   TARKGIA"
     atgaagtcat tttctggaaa agttgccgcc attacaggag cgggctccgg tatcggccag        60
     gccacagcca ttgcactggc aaaaaaggga tgccatttgg ctatctcaga tataagccaa       120
     gaaagcctcg agaaaaccat caagatgctt gcccattatc cggtgaaagt tagcagccat       180
     gtcgttgatg tcagcgatcg cgaagcggtc tataaatacg cggacgacac cgttactgag       240
     cacggcaagg tcaacatcat catgaacaat gcgggtgttg gtcttggtga aaccgtagaa       300
     aacatgagct acgagaactt tgaatggctt atgaacatca atttttgggg cgtggtatac       360
     ggcaccaaag cattcctgcc gcacctgaag cgtgctgatg aagggcacat catcaatatc       420
     tcaagcgtgt tcggcattat cggcgtaccg actcaatctg cctacaatgc cgctaaattt       480
     gctgtacgcg gttttacaga atcgctgcgc gaagagcttg atatagaggg cggccgcgtc       540
     agcgctactt cagttcaccc tggaggggtc aaaaccaata tcgctcgcaa cagccgcatg       600
     ggcgacatgg gtgacatggg tatcggtgac aaagaagata ttgccgatat gtttgaaaaa       660
     atcgctatga ccacaccaga aaccgcagca aaaactattc taaaagctgt acgcaagaac       720
     cggcggagag tattggtggg cggcgatgcc atcatgctcg acaccaccca gcgcctgatg       780
     cccacaggct atcagcggct gctcgaagtt atgtttaaaa agcagcaagg caagaatagc       840
     aaaaccgccc gcaagggcat tgcttaa                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page