(data stored in ACNUC7421 zone)

EMBL: AM286690.PE190

AM286690.PE190       Location/Qualifiers
FT   CDS_pept        complement(201822..203348)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0190"
FT                   /product="monooxygenase, putative"
FT                   /EC_number="1.14.13.-"
FT                   /note="(monooxygenase flavin-binding family) identified by
FT                   sequence similarity; putative InterPro: Flavin-containing
FT                   monooxygenase (FMO)"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15638"
FT                   /db_xref="GOA:Q0VT82"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT82"
FT                   /protein_id="CAL15638.1"
FT                   /translation="MKHRHLDVLIIGAGLSGVGAACHLNRDCPDLRYEIVERRKRVGGT
FT                   WDLFRYPGIRSDSDMFTLGYNFRPWTDTKMLADGPSIRKYIEETAEQHQVVDKIHFGLK
FT                   VLSEEWSSESNRWTVTAQNEETGEEETFTAGFVLNCTGYYNYDAGHTPKIPGITRFGGD
FT                   VIHPQHWPENYDYSGKRVVVIGSGATAVTLVPAMADNASHVTMLQRSPSYVASVPEQDL
FT                   ISKNLRRVLPEMVVYRMARARNVLLQRSVFQLSIRKPKAIRRLLLAAARKQLGPDFDMK
FT                   HFQPHYNPWEERLCAVPKGDLFRVLREGKASVVTDHIASVTKTGIKLKSGELLPADIIV
FT                   TATGLDLQMFGGASIRVDGKEPSISDTMMYKGLMLENIPNMAFVFGYTNASWTLKADIA
FT                   SEFVCRLLKHMQKTGADKVTPVDEEDCGTDVNFLNLRSGYIQRADDRLPRQGTKQPWQT
FT                   LNDYLRDLPALRYGKLDDGYLHFEGKNLHKPKRKLVQQLLGSALTKEAQR"
     atgaaacaca gacatctaga cgttctaata ataggtgctg gcctgtccgg cgtgggagca        60
     gcttgccatc ttaaccgcga ctgccctgat ctacgctacg aaattgtcga gcgtcgtaag       120
     cgagtaggcg gcacatggga cctatttcgc taccccggca ttcgttcgga ctcagatatg       180
     tttactctcg gctataactt tcggccttgg acagacacaa aaatgcttgc cgacggtccc       240
     tccatccgca agtacatcga agaaactgcc gaacagcatc aggtcgttga caaaattcac       300
     ttcggtctca aagttctttc cgaggagtgg agtagcgaga gcaatcgctg gaccgtcacc       360
     gcccagaacg aggaaaccgg tgaagaggaa accttcacag ccggatttgt gctcaattgc       420
     actggctact acaactatga tgctggccac acacccaaaa tacccggcat aacgcgcttt       480
     gggggcgacg tcattcatcc tcagcactgg cctgaaaatt acgattacag tggtaaacgg       540
     gtggtcgtaa tcggtagcgg agccacagct gtaacgctgg taccggcaat ggcagacaat       600
     gcctctcatg tgaccatgct acagcgttct cccagctatg ttgcatccgt tccggagcaa       660
     gatctaatct ctaaaaacct gcgtcgtgta ttaccagaaa tggtcgttta ccgtatggct       720
     cgcgcgcgca acgttttact tcagagaagc gtattccaac tgtcaatccg aaagcccaag       780
     gctatccgca gattactgtt agccgctgcc cgtaagcagc ttgggccaga tttcgacatg       840
     aagcatttcc aaccgcacta caatccttgg gaagagcggt tgtgcgcggt gccaaagggc       900
     gatctcttcc gggttcttcg tgaaggcaaa gcctcggtgg taacagatca tatagctagc       960
     gtgactaaaa ctggcataaa gcttaaatcc ggagaacttc ttcccgcaga tatcatcgtc      1020
     acagccaccg gtctggattt gcaaatgttc ggcggcgcaa gcattcgtgt ggacggtaag      1080
     gaacccagta tttcagacac catgatgtac aaagggttaa tgcttgaaaa catccccaat      1140
     atggcattcg tctttggtta taccaatgcc tcctggaccc taaaagccga tatcgcttcc      1200
     gagtttgttt gtcgcctact caagcatatg cagaagaccg gcgctgacaa ggtgacaccc      1260
     gttgacgaag aggactgtgg aactgacgtc aacttcctca accttcggtc aggatacatt      1320
     cagcgtgccg atgatcgcct accacgccaa ggaaccaaac agccttggca aacactgaac      1380
     gattacctgc gcgaccttcc cgcccttcgt tatgggaagc ttgatgatgg ctacctgcat      1440
     ttcgaaggca aaaatctcca taaacctaag cgcaaactgg ttcaacagct actcggcagc      1500
     gcgctaacca aagaggcaca acgatga                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page