(data stored in ACNUC7421 zone)

EMBL: AM286690.PE191

AM286690.PE191       Location/Qualifiers
FT   CDS_pept        complement(203345..204301)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0191"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to TIGR protein family
FT                   HMMTIGR01738 InterPro: Alpha/beta hydrolase fold"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15639"
FT                   /db_xref="GOA:Q0VT81"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT81"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR01738"
FT                   /protein_id="CAL15639.1"
FT                   /translation="MHYQDNPTTRNQSASSAPPETGRDIQFQGNGGLALSATRFGDPKS
FT                   PQVLLLHGGGQTRHAWTHTATVLAKAGYCATIIDARGHGQSQWCPKGDYSATALVSDLR
FT                   AIIQSLPSSPYIVGASMGGLTAMLALGEEASLNCRGLVLVDVAPKLERNGVRRIIEFMR
FT                   RHRDGFDSLEQVRDAVAAYNPGRKAPANSQGLRKNLREDVNGRLHWHWDPAFLDHAEIP
FT                   ETDESMFGGARLNRAARHLSMPILLIRGYHSDVLSETGAQELLALVPQAQYRVIEQAGH
FT                   MVAGDRNSIFTGAVMDFLQSIDPPIQQIRSTERRVKT"
     atgcattatc aagataatcc cacaacgcgt aaccagagtg cttcaagtgc ccccccggag        60
     actggcaggg acatacagtt ccaaggaaac ggaggtttgg ctcttagtgc gacccggttc       120
     ggtgatccaa agtcgccgca ggtgctactg ctacatggcg gcggacagac tcgtcatgca       180
     tggacgcaca cggcaaccgt cctggcaaag gccgggtact gcgccactat catagacgcc       240
     cgaggtcatg ggcaaagcca gtggtgtcca aaaggtgatt acagcgccac tgccttggtg       300
     tccgacctcc gcgctatcat tcagtcgctc ccctcgtcgc cgtatatcgt cggtgcatca       360
     atgggtggcc tcactgccat gctcgcgctt ggagaagagg cttctctgaa ctgccgtggc       420
     cttgtactgg tagatgtggc tcccaagctg gaacgcaacg gcgttcgccg gattattgaa       480
     ttcatgcgtc gccaccgtga cggatttgac tctctggagc aggtgcggga cgcggtcgct       540
     gcctataacc cggggcgcaa agcacccgcg aattcacagg gtctccgcaa aaacctgcgt       600
     gaggatgtga acggtcgtct ccactggcac tgggatccag cgtttcttga tcatgccgag       660
     atccccgaaa cagatgaaag catgttcggc ggggcccgac tcaatcgtgc ggcgaggcac       720
     ctcagcatgc cgatattact gatccgtggt taccacagtg atgtactcag cgaaacaggt       780
     gctcaagagc ttttggccct ggtaccccaa gcccagtacc gggtgattga gcaagcgggt       840
     catatggtag ccggtgaccg caatagcatt tttacggggg ctgtgatgga tttccttcaa       900
     tcgattgatc cgcccattca acagatacgc tccactgagc ggagagttaa aacatga          957
//

If you have problems or comments...

PBIL Back to PBIL home page