(data stored in ACNUC7421 zone)

EMBL: AM286690.PE197

AM286690.PE197       Location/Qualifiers
FT   CDS_pept        complement(213808..214740)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0197"
FT                   /product="metal-dependent hydrolase, putative"
FT                   /note="predicted metal-dependent hydrolase"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15645"
FT                   /db_xref="GOA:Q0VT75"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT75"
FT                   /protein_id="CAL15645.1"
FT                   /translation="MALANRKIGYDEVVTRDIHFPMNIENVARHWFGNDPWSTHWMNAI
FT                   LAAVPDGERWVMNSARRQLSKLDDPEVLNAAKEFIRQERIHAREHDEMNAIGVQHGVPI
FT                   DKVEGVFKLIRKQLQHRLSDDMQSSIAAAFEHFTAIISSVLLEHPELFDETHPELRAML
FT                   YWHFVEETEHKSVSYDVFVDASGGGFRSYRLRASGMLLAIALGFPLMIGNQTYLLYKDR
FT                   QILNLRSAAKMTKVLFWRPGILSKVLGGVTPYFSPTFHPWDDDNRDVIRIWKRAYEKTG
FT                   DAQKAYQALRDHRAKHAPETLSAPQAEPA"
     atggccctag caaatcgcaa gatcggttac gacgaggttg taacccgtga cattcacttt        60
     cccatgaata tcgaaaacgt ggcccgccac tggttcggta atgacccttg gtccacccac       120
     tggatgaacg ccatccttgc cgccgtccca gacggcgagc gctgggttat gaactcagcc       180
     aggcgacaac ttagcaagct tgacgacccg gaggtgctca atgccgccaa ggaattcatt       240
     cgccaagagc gcattcatgc tcgcgagcac gacgaaatga atgccatcgg ggtgcagcat       300
     ggggttccca tcgacaaagt cgaaggcgtc ttcaaactga ttcgaaagca actccagcac       360
     cgtctcagtg acgacatgca gagctccatc gctgcggcgt tcgagcattt cactgcgatt       420
     atctcctcgg tactccttga gcatccggaa ctttttgacg agacccaccc agaactgcgc       480
     gccatgctct attggcactt tgttgaagaa accgagcaca agagtgtcag ctacgacgtg       540
     ttcgtcgatg ccagtggcgg cggctttcgc agctaccggt tgcgcgccag tggcatgcta       600
     ctagccatcg ccctgggttt tcccctcatg attggcaacc agacctatct actctacaaa       660
     gatcgccaga ttctgaatct gcgctcagca gcaaaaatga ccaaggtgtt gttctggcgg       720
     cccggcattc tctccaaggt cctcggtggt gtaacaccct acttctcacc caccttccat       780
     ccttgggacg atgacaaccg tgatgtgatt cgtatctgga agcgcgccta cgaaaaaacc       840
     ggcgatgccc agaaggcgta ccaggcactg cgagatcacc gcgccaagca cgcaccggaa       900
     acactttctg caccacaggc tgagcccgca tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page