(data stored in ACNUC7421 zone)

EMBL: AM286690.PE208

AM286690.PE208       Location/Qualifiers
FT   CDS_pept        225878..226510
FT                   /transl_table=11
FT                   /locus_tag="ABO_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15656"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT64"
FT                   /protein_id="CAL15656.1"
FT                   /translation="MRIVVLLMAFILVSPLLPSSVWARSGQRANERMPDGAYFRHETTD
FT                   GVVHLNRTLTMDAIRNGYQLLDQYGRVLEDVEGVELNDAQAKAQRMKQARQAREDRDML
FT                   RLYAGPEDAERARDRRVEALELSISYEENNLAQLQAKLDDEIATAARNERAGREVPEVV
FT                   KEAIDRLQRQIITAEKKLSEFDQEIDQANQQYAPIIERLEVIEKGQN"
     atgagaatcg tcgtcctgtt gatggcgttc attttggttt cgccattact gccttcgtcg        60
     gtttgggcgc gttccgggca gcgcgcgaat gagcggatgc cggatggcgc ctactttcga       120
     catgaaacca cggatggtgt ggtgcacttg aaccgaaccc tgacgatgga tgctatccgc       180
     aacggttatc agttgttgga tcaatatggc cgggtgctgg aggacgtgga gggtgtggag       240
     ctcaatgacg cccaagccaa ggcccagcgg atgaagcagg ctcgccaggc acgggaagat       300
     cgcgatatgt tgcgattata tgccggcccg gaagatgcgg agcgggcgcg ggaccgtagg       360
     gtcgaagcgc tggagctcag tattagttac gaagagaata atctggctca gttacaggcg       420
     aagctggatg atgagattgc cacggcggca cgcaatgagc gggcgggtag agaggtgccg       480
     gaggtggtta aagaagcgat tgatcggttg caacggcaga tcatcaccgc ggaaaaaaaa       540
     ctaagtgagt tcgatcaaga aatagatcaa gccaatcaac aatacgcgcc aattattgag       600
     cgtcttgagg ttattgagaa aggccagaat tag                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page