(data stored in ACNUC7421 zone)

EMBL: AM286690.PE218

AM286690.PE218       Location/Qualifiers
FT   CDS_pept        235444..236340
FT                   /transl_table=11
FT                   /locus_tag="ABO_0218"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15666"
FT                   /db_xref="GOA:Q0VT54"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT54"
FT                   /protein_id="CAL15666.1"
FT                   /translation="MGARWLYMLPALILSVVAVILALVGLARDPSPAKPERAGADEALA
FT                   QQRAADKPKYTYWVATRELNIGSIVADDDFQKIDVSAPLSSALQADAQVVGQRLFQHVR
FT                   NGEILSQVHLEAGNRLAQSVPAQFRAFAIDIDNASAVGGLLEPGDLVDVLVHFRKGQDE
FT                   QPTSMILLKAIEVLAVKGQLQDADKTDEEKEKSRSRNATAVLAIPREALPKLLLADSNG
FT                   ELRLAMAGEDIGSEQNESAGGGAVGLSGKEQKELMLTTKLDSLFPEKKPVRRSVAPPRG
FT                   NKVEVYEGSTSRSTYVR"
     atgggggctc gttggctcta tatgctacct gcgctaatac tgagtgtggt ggcggtgatt        60
     ttagccctag tgggtctggc tcgagatcct tcgccggcaa aaccggaaag ggcaggagcg       120
     gatgaggcgc ttgcgcaaca gcgtgctgcg gataaaccta aatatactta ctgggttgca       180
     acacgagagc taaacatagg ttcgattgtt gcggatgatg attttcaaaa aattgatgtt       240
     tctgcgccat tgtcgtctgc tctgcaagct gacgctcaag tggtggggca gcgtttattt       300
     cagcatgttc gcaacggcga aattctctct caggttcacc tagaagccgg taatcgtctg       360
     gcgcagtctg ttcctgctca gttccgagca tttgccatcg atattgataa tgcctcggct       420
     gttggcgggc tgttggagcc tggtgatttg gtggatgtgt tggtgcattt tcgcaagggg       480
     caagatgaac aacccacgag catgattttg cttaaggcta ttgaagtatt ggcggtaaaa       540
     ggccagcttc aggatgccga taagacggat gaagagaagg aaaagagtcg ttcaagaaac       600
     gcgactgctg tcttggcgat accccgcgaa gccttgccta aattgttgtt agctgacagc       660
     aatggcgagc tgcgcttggc tatggctgga gaggatatag gaagcgaaca aaatgagagt       720
     gctggcggtg gagctgtcgg tctcagtgga aaagagcaga aggaattgat gcttactact       780
     aagctggatt ctttgttccc tgagaaaaaa ccggtaagac ggagtgtggc cccccctcgc       840
     ggaaataaag tggaagtcta tgaaggatcg acttcaagga gtacttatgt acgttga          897
//

If you have problems or comments...

PBIL Back to PBIL home page