(data stored in ACNUC7421 zone)

EMBL: AM286690.PE219

AM286690.PE219       Location/Qualifiers
FT   CDS_pept        236330..237550
FT                   /transl_table=11
FT                   /locus_tag="ABO_0219"
FT                   /product="type II secretion system protein, probable"
FT                   /note="Bacterial type II and III secretion system protein
FT                   family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15667"
FT                   /db_xref="GOA:Q0VT53"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT53"
FT                   /protein_id="CAL15667.1"
FT                   /translation="MYVEVIQKKVSERCNGKSRVAGTVLSRRSLFAMLLSHLSVVGIAL
FT                   SALFSVPVGADSFEKVMRMGPGDQHVVAFADRVTKVATSSPDAVAVAVSAPAELLLTAQ
FT                   QEGSSVLTVWLDGMDEPLRSTVVVAATAGKRLPFGTQVQTDIRIMEVSRSKLNSFGFEY
FT                   SNIFDGGNTQVGVASPGGGGPSDSFNLFRLGKNSTTIINALESGGFAYTLAKPSLTALS
FT                   GQTATFLSGGEFPVPTRSDNNGVQVEFKSFGIGLALTPTVISGDQIILKVAPEVSELDF
FT                   SAGVESAGTSIPGLRVRRSETTVSLAPGETFIISGLVSQNTVNNSNRIPGLGNLPVLGA
FT                   FFRSGQLSREDKEMVMVVTPHLVSPGSSTEAGPLPGAGYHNSSTGWLDMMTETRNGSRP
FT                   VRHGLSW"
     atgtacgttg aggtgataca gaaaaaggtg tcggaacgat gcaatggaaa gtctcgagtt        60
     gccggtacgg ttctgtctag acgctctttg tttgcaatgc tgttgtcgca tctatcagtt       120
     gttgggatcg ccctgtctgc gcttttttcc gtgccagtgg gtgcggactc ctttgaaaag       180
     gtgatgcgca tggggccggg ggatcagcat gtggtagctt ttgctgatcg tgtaacaaag       240
     gttgccacct ccagccctga tgctgtcgct gtggctgtca gtgctcctgc tgagctattg       300
     ctgactgctc agcaggaagg atcgtcggtg cttactgttt ggttagacgg tatggatgag       360
     ccattaagga gtacggtggt tgttgccgcg acggcaggaa aaagattgcc gtttggaacc       420
     caagtgcaaa cggatattcg gattatggaa gttagccgga gcaagcttaa tagctttggt       480
     tttgaatatt ctaatatttt tgatgggggc aatactcaag tgggcgttgc ctcaccggga       540
     ggcggaggcc cctccgatag tttcaactta tttcgtcttg gcaagaattc aacaacgatt       600
     attaatgcgc tagaaagtgg agggtttgct tataccctgg cgaagccttc tctgaccgca       660
     ctcagtggtc aaacggctac ttttctttct ggtggcgagt ttcctgttcc tactcgcagt       720
     gataataacg gcgtgcaggt tgagtttaag agttttggta ttggtttggc attgacgcca       780
     actgttatca gtggcgacca aattattctc aaagtagcgc cagaggtgag tgagctagat       840
     ttctccgccg gggtggaaag tgctgggacg tctattcctg ggcttagggt tcgccgctcc       900
     gaaacaaccg tttcgttggc gccgggggag accttcatta ttagtggtct ggtaagtcaa       960
     aacacggtga ataatagcaa tagaattcct ggtttgggca atttgcctgt gctaggtgcc      1020
     ttttttcgct cgggtcaact gtcacgagaa gacaaggaaa tggtgatggt ggtgacgcct      1080
     catcttgtgt caccgggatc gtcgactgag gccggtccat tgcccggtgc tggctaccac      1140
     aatagcagta caggttggtt ggacatgatg actgaaactc gcaatggatc tcggccagtt      1200
     cgtcatggct tgagctggta g                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page