(data stored in ACNUC7421 zone)

EMBL: AM286690.PE225

AM286690.PE225       Location/Qualifiers
FT   CDS_pept        242499..242783
FT                   /transl_table=11
FT                   /locus_tag="ABO_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15673"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT47"
FT                   /protein_id="CAL15673.1"
FT                   /translation="MNKTLLFFVTVFMSAFSYADAEQYDYGLSSPGLLSQHETTTERLL
FT                   KQQRLAPVTPESELSAQLYVDSQIRIGETFKTAIPDSLQERADSLSEGD"
     atgaacaaaa cacttttatt tttcgttacg gtatttatga gcgccttttc ttatgctgac        60
     gctgagcaat acgattacgg tttatcttcg ccgggattgc tttctcagca tgagacaaca       120
     acagagaggc tgttgaagca gcaaagatta gcgccagtta cacctgaaag tgagttgtca       180
     gcgcaattat atgtagatag tcagataagg attggtgaaa cgtttaaaac agctatcccg       240
     gatagtttgc aagaaagagc ggactctctt agtgaaggtg attag                       285
//

If you have problems or comments...

PBIL Back to PBIL home page