(data stored in ACNUC7421 zone)

EMBL: AM286690.PE229

AM286690.PE229       Location/Qualifiers
FT   CDS_pept        247037..247423
FT                   /transl_table=11
FT                   /locus_tag="ABO_0229"
FT                   /product="glyoxalase/bleomycin resistance family protein,
FT                   putative"
FT                   /note="(gloxalase/bleomycin resistance family protein
FT                   putative) identified by sequence similarity; putative
FT                   identified by match to PFAM protein family HMMPF00903
FT                   InterPro: Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15677"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT43"
FT                   /inference="protein motif:HMMPFAM:HMMPF00903"
FT                   /protein_id="CAL15677.1"
FT                   /translation="MFEVKATQHVLAVNNVDESERCFLDKLGFSVRFRVDGWSFLSLGS
FT                   FHIMLGHCPDEISAEATNEHSYFAYVNCVGIDDIYGDYRKRGVDIFQTISNKPWGLREF
FT                   GVVTPDGHRIMFGEDIGKSFARGL"
     gtgtttgaag ttaaagcaac tcagcatgtt ttggcggtca ataatgttga tgaaagtgaa        60
     cgatgttttt tagataagct tggtttttct gttcgctttc gagtagacgg ctggtcgttc       120
     ctgagccttg gcagttttca tattatgttg gggcattgcc cggatgagat ttctgctgaa       180
     gcgaccaatg aacattctta ctttgcgtat gtgaattgcg tgggcattga tgatatttat       240
     ggtgattatc ggaagcgcgg tgttgatatt tttcagacta tttctaataa accttggggg       300
     ttgcgtgagt ttggcgtagt tactccagat gggcacagaa ttatgtttgg cgaagacatc       360
     ggaaaatcgt tcgctagggg cctttga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page