(data stored in ACNUC7421 zone)

EMBL: AM286690.PE23

AM286690.PE23        Location/Qualifiers
FT   CDS_pept        complement(26119..27051)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0023"
FT                   /product="conserved hypothetical protein"
FT                   /function="it catalyses the first step of phytanic acid
FT                   alpha-oxidation"
FT                   /note="conserved hypothetical protein;"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15471"
FT                   /db_xref="GOA:Q0VTN7"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="InterPro:IPR012774"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTN7"
FT                   /protein_id="CAL15471.1"
FT                   /translation="MSAQNLTCPASIQTDPYPTRLHQHPDQPWYKRQEHTVKGRHLPGP
FT                   LSQSQLDNFEQNGFLFERGFLHSDEVNALSNAMSELLNRNDYRNRSFTITEPDSQEIRS
FT                   VFAVHFLHRAFQRLARDPRLTDRVKQILGGEHYIHQSRINYKPGFKGKGFNWHSDFETW
FT                   HAEDGMPAMHAVSASIILTDNHTFNGPLMLIPRSHQHFIPCIGETPDEHHKQSLKKQQI
FT                   GVPPEDALSAMINRNGIEAPTGPAGSLLLFDCNTLHGSNANMAPDPRSNVFFVFNRQDN
FT                   ACQAPYAAKKPRPSFLCHTPNQLWQPNDH"
     atgtcagcgc agaacctaac ttgccctgca tcgatacaaa ccgatcctta tcccacccgg        60
     ttacatcaac acccggacca accttggtac aagcgtcagg agcatacggt gaaaggccgc       120
     catcttcctg ggccgctttc ccaatcacaa cttgataact ttgagcagaa cggctttctg       180
     ttcgaacgcg gttttttgca cagcgatgaa gtgaacgcgc tttctaacgc catgagcgag       240
     cttctcaatc gtaatgacta tcgaaatcgc tctttcacaa ttaccgaacc tgacagccag       300
     gagattcgtt ctgtctttgc ggtacacttt ttacatcgcg ctttccaaag actggcccgt       360
     gacccacgcc taaccgatcg ggtgaagcag atattgggag gtgaacatta tattcaccaa       420
     tcacgcatta actataagcc agggttcaaa ggtaaaggct ttaattggca ttctgacttt       480
     gaaacttggc acgccgagga cggcatgcca gccatgcacg cggtaagtgc ctcaatcatt       540
     cttactgata accacacgtt caatggccca ctaatgctga ttcccagatc ccatcagcat       600
     ttcattccct gtataggaga aacgccagac gaacatcaca aacagtcgct gaagaagcag       660
     caaattggtg tgccgccaga agatgccctg agcgcaatga tcaatagaaa cggcattgag       720
     gcgcccacgg gccccgcggg cagcctgctg ttgttcgact gtaatacgct gcatggttct       780
     aatgccaata tggcaccgga tccacgtagc aatgtcttct tcgtattcaa ccgacaggac       840
     aatgcctgcc aggctccgta tgcggcaaag aaacctcggc caagttttct atgccacaca       900
     ccaaatcaac tatggcagcc caacgatcat taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page