(data stored in ACNUC7421 zone)

EMBL: AM286690.PE235

AM286690.PE235       Location/Qualifiers
FT   CDS_pept        complement(252461..254707)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15683"
FT                   /db_xref="GOA:Q0VT37"
FT                   /db_xref="InterPro:IPR008520"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT37"
FT                   /protein_id="CAL15683.1"
FT                   /translation="MRRFLFALPFVLGAVAVIWIGTTFLGNPVAFTVTLLIAAVYGLGF
FT                   VELLRYRRDTAKLNLRLQQLPHPNDGRETLTRWLSELPNTLRHAVQRRVDGHPATLPGP
FT                   VLTPYLTGLLVMLGLLGTFVGMIVTLKGAATALDGSSELSAIRSALSAPIAGLSLAFGT
FT                   SIAGVAASAMLGLTATLCRRDRMDASRQLDDAVDGQLYRFSLNHQRETAYAALQSQSQV
FT                   FPELVTALHTLTGRMEQMGEQLTGNQQAFHNGLQEQYQGLARSVADSLRDTLTDSSRLA
FT                   AESAQSIMAQSLASLSEQAQGTHEKLNAITEQQLGALTERFRDTTEQAAEHWRAGLAEH
FT                   QQTSARLVSDISTSLAAHHDQFQHNSNSLLQQVRDTQQQLGNASEQQLATITGEFQTAS
FT                   RQALQDWNAGLEAHRASGAELLQQVRDTQQAVAEHSEKQFSAIAGQFQASTEQAAQQWQ
FT                   TGLSEQQRTVATLVNDIRNALHEHNSEFRDSAAGLLSGQQTGMDSLINQLGEQLSVLRD
FT                   QEAARGDAASERLAKLEATVSEHLGRLGTALEEPMMRLIETASETPKAVAEVISRLREE
FT                   MTHSSERDNELLEERRRIMAELDTLLSAQQDAAGAQRDAIDTLIRTSSETLSQVSDTFS
FT                   QQVSDQASQLNQVAGDVAGSAAEVASLSDAFATAVQVFSRANDTLLDNLQQVESSLEKS
FT                   SARADEQLGYYVEQAREVIELSMASQKEVIDALANLRHGDAPAHNGQRSVSGVN"
     atgagacgtt ttctatttgc tctcccgttt gtcctcggcg ccgtggccgt tatctggatc        60
     ggcaccacct tcctgggtaa cccggtggcc ttcaccgtta ccctgctgat cgccgccgtc       120
     tacgggctcg ggtttgtcga attactgcgc taccgccgcg ataccgccaa gttaaacctg       180
     cgactacaac aattacccca ccctaacgat ggccgcgaaa cgctgactcg ctggctcagc       240
     gaactaccca acaccctgcg ccacgccgtg caacgccgtg ttgacggcca tccggccacc       300
     ctgcccgggc cggtactgac cccatacctc accggtttac tggtaatgct cggcttgctg       360
     ggcaccttcg tgggcatgat cgtcaccctc aaaggcgccg ccaccgcctt ggatggcagc       420
     agtgagctga gcgccattcg cagcgcgttg tccgcaccta ttgccggcct aagtctggcc       480
     tttggtacct ccatcgccgg ggttgctgcc tccgccatgc ttggcctcac cgcgaccctg       540
     tgtcgccgcg accgcatgga cgcctcccgt cagctagacg atgcagtgga cggccagctg       600
     tatcgctttt ctctaaacca ccaacgcgaa acggcctacg cggccctgca aagccagtcc       660
     caggtgttcc cggaactggt caccgccctg cacaccctca ccgggcgcat ggaacaaatg       720
     ggcgaacagc tcaccggcaa ccagcaggcc ttccacaatg gactccaaga gcaataccaa       780
     gggttggcgc gttccgttgc tgattcttta cgtgacaccc taaccgacag cagccgcctg       840
     gccgccgaga gcgctcaatc aatcatggcg caatccctcg ccagcctcag cgagcaggct       900
     caaggcaccc acgaaaagct caacgcaatc accgaacaac agctcggcgc ccttaccgaa       960
     cgtttccgtg acaccaccga gcaagccgcc gaacactggc gcgccgggct ggccgagcat      1020
     cagcaaacca gtgcccggct ggtgagtgac atcagcacct cgctggcggc tcaccacgat      1080
     cagttccaac acaacagcaa ttccctactg caacaggtcc gtgacaccca acaacaattg      1140
     ggcaatgcca gtgagcaaca actcgccacc atcaccggag aattccagac tgcctcccgt      1200
     caggcactgc aagactggaa cgccgggctg gaggctcacc gggccagcgg cgcagaactt      1260
     ctccaacaag tacgcgacac tcaacaggcc gtggccgaac acagtgaaaa gcagttttct      1320
     gccatcgccg gccagttcca ggccagcacc gaacaggccg ctcaacagtg gcaaaccggc      1380
     ctcagcgagc agcaacgcac cgtggccacc ttggttaacg atattcgtaa cgctctgcac      1440
     gagcacaaca gcgaattccg tgacagcgct gccggcctgc tcagcggcca gcaaacgggc      1500
     atggacagcc tgatcaacca gctgggtgag caactcagtg tgttgcgcga tcaagaagcc      1560
     gctcgcggtg acgccgccag cgagcgccta gccaagcttg aggccaccgt cagcgagcat      1620
     ctaggtcgcc tgggcactgc tctagaagaa ccaatgatgc gcttgatcga aaccgcctcg      1680
     gaaacaccga aagcggtcgc ggaagtgatt tcccgcctgc gcgaagaaat gacccacagc      1740
     agcgagcggg acaacgaact gttggaagaa cgtcgccgca tcatggccga gctggatacc      1800
     ttgctcagtg cccagcagga tgccgccggc gcccagcgtg acgctatcga caccttgatt      1860
     cgcacctcca gcgagacgct gagtcaggtg agcgacacct tctcgcaaca ggtcagcgac      1920
     caggccagcc aacttaatca ggtcgccggc gacgtcgccg gtagcgccgc cgaagtagcc      1980
     agcctcagcg acgcctttgc cacggccgtg caagtgttca gccgcgccaa cgacacccta      2040
     ctggacaatc ttcagcaggt ggaaagctca ctggagaaat cctctgcccg ggccgacgag      2100
     caactgggct actacgtgga gcaagcccgc gaggtgattg agctcagcat ggcctcacag      2160
     aaagaagtca ttgatgccct ggccaaccta cgccatggcg atgcccctgc gcacaatggc      2220
     cagcgctcgg tttccggggt taattga                                          2247
//

If you have problems or comments...

PBIL Back to PBIL home page