(data stored in ACNUC7421 zone)

EMBL: AM286690.PE239

AM286690.PE239       Location/Qualifiers
FT   CDS_pept        257639..258928
FT                   /transl_table=11
FT                   /locus_tag="ABO_0239"
FT                   /product="Uncharacterized iron-regulated protein"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15687"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT33"
FT                   /protein_id="CAL15687.1"
FT                   /translation="MLTRLSTGGLLLATLFFSACSDEPQSSGAVVAQAYDQTQGKKVVS
FT                   HYADVALATYTDALAEARKLKTQIDALLAAPTEDSLTAARDAWRAARVPYMQSEVFRFG
FT                   NVVVDEWEGQVNAWPLDEGLIDYVDEDYHAVMGNPGARANIIASESLKIGEQALDLTDL
FT                   SAELLASLNELGGSEVNVATGYHAIEFLLWGQDLNGTDAGAGERPATDFATGPQATGGH
FT                   NARRREYLSVVTDLLINDLEVMVDEWRPGEENYRAELEADSVENGLRKMLFGMGSLSLG
FT                   ELAGERMKVALAAHSPEDEHDCFSDNTHASHFYNGKGIRNVYLGEYRRVNGETLTGPSL
FT                   SDLVAANKPAIDNQLKADLEASRAALQGLVDSANKGIHFDQLIAPGNSEGAATVNAAID
FT                   TLVAQTTSIEAAAAVLNIQALNPDTANHSF"
     atgctgactc gcctgtccac cggcggcctt ttactggcca ccctgttttt ttctgcctgt        60
     agcgatgaac cgcagtccag cggggccgtt gttgcgcagg cctatgatca gacgcagggc       120
     aagaaggtgg tcagccacta tgctgacgtg gcgttggcga cctataccga tgcgcttgcc       180
     gaagctcgca agttgaaaac tcaaattgat gcgttactgg cagcacctac ggaagatagc       240
     ctaactgcgg cccgggatgc ttggcgtgcg gcccgggtgc cctacatgca gagtgaagta       300
     tttcggttcg gcaatgtggt ggtggacgaa tgggaaggac aggtgaatgc ctggccgctg       360
     gatgagggcc tgattgatta cgtggatgag gattatcacg cggtgatggg caaccccggc       420
     gcccgcgcca atattattgc cagcgaatcc ttgaagattg gtgagcaggc tctggatttg       480
     acggacctga gcgcagagtt gttagccagt ttgaatgagc tagggggctc cgaggtgaat       540
     gtggccaccg gctatcatgc tattgaattt ttgttgtggg ggcaggactt gaatggaacc       600
     gacgctggtg ccggtgagcg cccggcaacg gattttgcca ccggcccgca agccactggg       660
     gggcataatg cccgccgccg cgagtacctg tcggtggtta ccgatctgct gattaacgat       720
     ctggaagtga tggtagacga atggcgtccg ggtgaagaga actaccgggc tgagctggaa       780
     gccgactcag tggagaacgg ccttcgcaag atgttgtttg gcatgggaag cctgtcattg       840
     ggcgagttgg ctggagagcg gatgaaggtg gcacttgcgg cccattcccc agaagacgag       900
     cacgactgtt ttagtgacaa tacgcatgcg tcgcattttt ataatggtaa gggcattcgc       960
     aatgtgtatc tgggcgagta tcggcgagtg aacggtgaaa ccttgaccgg cccttccttg      1020
     agtgacttgg tggccgccaa taagccggcc atcgacaacc aattgaaagc cgacttggag      1080
     gctagccgcg cggcgctgca ggggctggtg gacagtgcca acaaaggcat tcattttgat      1140
     cagttgattg cgccagggaa tagcgagggg gcggccacgg tgaatgcggc catcgatacc      1200
     ttggtcgcgc agactaccag tattgaggcg gccgcagcgg tgctaaatat tcaggcactg      1260
     aatccggata ccgccaacca cagcttctga                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page