(data stored in ACNUC7421 zone)

EMBL: AM286690.PE241

AM286690.PE241       Location/Qualifiers
FT   CDS_pept        260514..261551
FT                   /transl_table=11
FT                   /locus_tag="ABO_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15689"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR034984"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT31"
FT                   /protein_id="CAL15689.1"
FT                   /translation="MRALIMQGAVALSVLMLAACSNPRQEVTVQLATEVLLPAHQQWHD
FT                   SNAALMDSVEAYCADPQASVEKMKAAFFHAQSQWSYLQPLMIGPLSEGNRSWQVQFWPD
FT                   KRNLVVRQTEALLDEAGPLTGEQLEKASVVVQGLTAFEFVLFDESIALASSRDRYCPLL
FT                   KGIANHQWALSEEVLKLWRGPEGMLLQLSDFPNERYATADDGLAAILRVQITGVDVLKK
FT                   KLGVPMGRLNKGVAQPYQAEAWRSQQSIENLQASLKGAWAVWQRVRSLVSDEGLVSDID
FT                   QAYADVNSRMEALPGPLVELVQAPSHRDTLAALYTALDQLENRQQIELARALNIQIGFN
FT                   ANDGD"
     atgcgtgctt tgattatgca gggggcggtc gcgttgtccg tgttgatgct ggcagcgtgt        60
     agcaacccac ggcaggaggt cactgttcag ctggccactg aggtgttatt gccggctcac       120
     caacaatggc acgacagcaa tgccgcgctg atggacagtg tggaggcgta ctgcgcggac       180
     ccgcaggcct cggtggaaaa gatgaaggcc gcattttttc acgcccaatc acagtggtct       240
     tacttgcagc cgttgatgat cggcccgttg tcggaaggca atcgtagctg gcaggttcag       300
     ttctggccgg acaaacgcaa cctggtggtt cgccagactg aagcgttgtt agacgaggcc       360
     ggcccactca ccggtgagca gctggagaag gccagtgtgg tagtgcaggg gctaaccgct       420
     tttgaatttg tgctgtttga tgaatcgata gcactggctt ccagccgtga tcgctattgt       480
     ccgttactga agggtattgc gaaccaccaa tgggcgttgt ctgaagaggt gttgaaactg       540
     tggcgtgggc ctgagggaat gttgttgcag ttaagcgatt ttcccaacga gcgctatgcc       600
     actgcggatg atggtctggc ggcgattctg cgggtgcaga ttaccggtgt ggacgtgctg       660
     aagaaaaaat tgggtgtgcc catgggccgg ctgaataaag gcgtggcgca gccctatcaa       720
     gcggaagctt ggcgtagcca gcaatctatt gaaaacctgc aagcgtcact aaaaggcgcg       780
     tgggcggtat ggcagcgggt acgttctctg gtgagcgatg aaggcttggt gagtgatatt       840
     gatcaggcct atgcggatgt gaatagccgg atggaggcgt tgcctgggcc gctggtggaa       900
     ttggtgcagg ccccctccca cagggatacg ttggcggcgc tttataccgc gctggatcaa       960
     ttggaaaatc ggcagcagat agagctggct cgggcactga atatccagat tggttttaac      1020
     gccaacgacg gagactag                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page