(data stored in ACNUC7421 zone)

EMBL: AM286690.PE244

AM286690.PE244       Location/Qualifiers
FT   CDS_pept        complement(263356..263772)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0244"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="transcriptional regulator MerR family identified by
FT                   match to PFAM protein family HMMPF00376 InterPro: Bacterial
FT                   regulatory proteins MerR family"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15692"
FT                   /db_xref="GOA:Q0VT06"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT06"
FT                   /inference="protein motif:HMMPFAM:HMMPF00376"
FT                   /protein_id="CAL15692.1"
FT                   /translation="MPTLFSIGALSNAAGCKVETIRYYEKIGLMPEPARSEGGQRRYHQ
FT                   RHRERLAFIRHSRELGFTLEDIRELLTMSEQHGCADDIARRHLETVEQRIRSLSALRDE
FT                   LGRMINECEQGRPGECRVIEVLSDHRKCTTEHGH"
     atgccaaccc tgttctctat cggcgcgctc agtaacgccg ccggctgcaa agtggagacg        60
     attcgctact acgaaaaaat cggattgatg ccggaaccgg cacgcagtga agggggacag       120
     cgacgctacc atcagcgcca ccgggaacga ttggccttta ttcgtcacag ccgcgaattg       180
     ggcttcaccc tggaagatat tcgcgagctg ctcaccatga gtgaacagca tggctgtgcc       240
     gatgatattg cccgccgcca ccttgagacc gtcgagcaac gaattcgatc actcagcgcc       300
     ttgcgcgatg aactgggccg aatgattaac gagtgcgaac aagggaggcc tggcgaatgc       360
     cgggttatag aagtgttaag cgatcaccgc aaatgcacca ccgagcatgg ccactag          417
//

If you have problems or comments...

PBIL Back to PBIL home page