(data stored in ACNUC7421 zone)

EMBL: AM286690.PE248

AM286690.PE248       Location/Qualifiers
FT   CDS_pept        265732..267018
FT                   /transl_table=11
FT                   /locus_tag="ABO_0248"
FT                   /product="ABC export system, membrane fusion protein"
FT                   /note="ABC export system membrane fusion protein identified
FT                   by sequencesimilarity; putative InterPro: HlyD family
FT                   secretion protein"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15696"
FT                   /db_xref="GOA:Q0VT02"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT02"
FT                   /protein_id="CAL15696.1"
FT                   /translation="MAAWHSAVRAFNFELAISSLHISCNISRYIPHHHYWSVELPMPRW
FT                   IRRFPKTVLFVVVLIVCLLFAGWRWGFSSAPATQWETATVERGDVEELVTALGTLEPGD
FT                   YVDVGAQVSGQLTHLYVDVGDSVEEGQLLAEIDASVQQTQVDAGLAELEALRAQLEQRQ
FT                   AELNLAELQYQRQQRLRDANATSEDAFQSAESNLAITGAQIKVLQAQIRQKQASVEGDQ
FT                   ATLGYAKIYAPRSGTVVSLDAREGQTLNANQTTPTLMRIADLSVMTISTEVSEADVHRL
FT                   SAGMPVYFNTLGNETVRYDSELRQVLPTPEVVNNVVLYTAEFDVANDNGQLMSGMTAQV
FT                   FFVVNSARDVLSLPMAAVKRAGRGAWKVQVLDSKGEPQDQPVKIGIDNRVRIVIDEGLE
FT                   EGDVVTLSQASSNVALKKNKDSLPRQGRF"
     ttggctgcgt ggcacagcgc tgttcgcgct tttaactttg aactcgcaat ttcctccctc        60
     cacatttctt gcaacatttc ccgttatatt cctcaccatc attactggtc tgtggaattg       120
     cccatgcctc gctggattcg tcgtttcccg aaaacggttc ttttcgttgt tgttttaatc       180
     gtatgcctgt tgttcgccgg ttggcgctgg ggcttttcgt cggcgccggc cacgcagtgg       240
     gaaacagcca cggtggagcg tggtgatgtg gaggaactgg tcaccgcgct gggcaccctg       300
     gagccgggag attatgtgga tgtgggtgcg caggtctcag ggcagttgac gcatttgtat       360
     gtggatgtag gggactcggt ggaggagggg cagctgctgg ctgaaattga cgcctccgtg       420
     cagcaaacgc aagtagatgc gggccttgct gagctggaag cgttacgtgc tcagttagag       480
     cagcggcagg ccgagttgaa tctggctgag cttcaatatc agcgtcagca gcgtttgcgt       540
     gacgcgaatg ctaccagtga agatgctttt caaagtgccg agtcaaactt ggcgattacc       600
     ggtgcccaga tcaaagtatt gcaagcacag attcgtcaaa aacaagccag tgtggagggc       660
     gatcaggcga cccttggcta tgcgaaaatt tatgctccac gcagcggcac ggttgtgagc       720
     ttggatgccc gtgaaggcca gacgcttaac gctaaccaga ctaccccgac actgatgcgc       780
     attgctgacc tgtccgtgat gacgatttcc acggaagtgt ccgaggcaga cgttcatcga       840
     ctaagcgcag gcatgccggt ttatttcaac acccttggca atgagacggt gcgctacgac       900
     agtgagctac ggcaagtgct gcctacgccg gaagtggtga ataatgtggt cctgtacacc       960
     gctgagttcg atgtggctaa cgataatggt cagttaatgt cggggatgac cgcgcaggtt      1020
     ttcttcgtgg ttaattccgc ccgcgatgtg ctgagcttgc cgatggctgc cgtaaagcga      1080
     gcggggcgag gggcgtggaa agttcaggtg ctggatagca agggggaacc acaggatcaa      1140
     ccagtgaaaa taggtatcga caatcgcgtt cgtatcgtga ttgatgaggg gcttgaagag      1200
     ggcgatgttg tgacgctgag ccaagcgagc agcaatgttg cgttgaaaaa aaacaaggat      1260
     agtctgccac gtcaaggacg gttctaa                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page