(data stored in ACNUC7421 zone)

EMBL: AM286690.PE249

AM286690.PE249       Location/Qualifiers
FT   CDS_pept        267018..268952
FT                   /transl_table=11
FT                   /locus_tag="ABO_0249"
FT                   /product="ABC transporter, ATP-binding protein/permease,
FT                   putative"
FT                   /function="responsible for the controlled efflux and influx
FT                   of substances (allocrites) across cellular membranes."
FT                   /note="(ABC transporter, ATP-binding protein/permease,
FT                   putative) identified by match to TIGR protein family
FT                   HMMTIGR01740"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15697"
FT                   /db_xref="GOA:Q0VT01"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VT01"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR01740"
FT                   /protein_id="CAL15697.1"
FT                   /translation="MPLIELCNIRKRYPAGDQDVEVLHGIDLSIEAGEFLAIMGSSGSG
FT                   KSTLMHILGCLDQPSDGEYRFSGQPVTAMDHDQLAWLRREMFGFVFQSYHLIGTASAWE
FT                   NVALPAIYAGVPREERKQRAQQLLTDLGLEDRLENRPSQLSGGQQQRVSIARALMNGGK
FT                   VILADEPTGALDSASGEAVMDQLRSLAEQGHTVIVITHDAKVAAHADRVVEIHDGNLIS
FT                   DTRHHDHLHERAKPVSAPPKESVMPDPGEVMEAVVMALRSLRANWMRTLLTLLGIVIGV
FT                   GAVVVMLAIGEGAKQDVVAQINERGTNLLVVRPDRGMQRVADGVIATLVPADAQALESL
FT                   PNISIAVPEISGNVTARANGMDISTSVQAVSEDFPSLRDWQPVQGIFFGEEDLKSYSPV
FT                   AVIGQTVKENLFPEGDPLGQFLLLDSIPFQVIGVMSAQGASDRGEDQDDVVIVPLSTGT
FT                   LRLFGQNYLNSITVAVDDVTQIDATEAAAVALLTQRHGKQDVRVFNMASLLEMVSETQN
FT                   TLTALLGSIAAISLLVGGIGVMNIMLVSVTERIHEIGIRMATGARQRNILQQFLTESVV
FT                   VSALGGIVGVVIGVLVGWLLMLFGMAIVFSVPVMVVSFVCAAGIGLLFGFAPALKAARL
FT                   NPVEALSND"
     atgccgttga ttgaactgtg taacattcgc aagcgttatc ctgccgggga tcaagatgta        60
     gaagtcttgc acggcattga tttgtccatt gaggcggggg agtttcttgc cattatgggc       120
     agttccggct cggggaagtc taccctgatg catattcttg gctgcctgga tcaacccagt       180
     gacggagaat atcgcttttc cggccaaccg gtgacggcca tggatcatga ccagctggcc       240
     tggttgcgtc gggaaatgtt tgggttcgta ttccagagtt atcacttgat tggcaccgcc       300
     agtgcttggg aaaacgtagc gttaccggct atttatgcag gcgtgccccg agaagagcgc       360
     aaacagcgag cgcagcagtt actgacagat cttggtcttg aagatcgcct ggaaaatcgt       420
     ccgagccaac tttccggggg gcagcagcag cgggtatcta ttgctcgggc cttgatgaat       480
     ggcggcaagg tgattcttgc cgacgagccc accggtgcgc tggacagcgc cagtggtgaa       540
     gcggtaatgg atcagctgcg cagcctggcg gagcaaggcc acaccgttat tgtgattacc       600
     catgacgcca aggtggccgc ccatgcggac cgggtagtgg agattcatga tggcaacctg       660
     attagcgata cgcgacatca tgatcatctc catgagcgtg ccaaaccagt gtcagcgccg       720
     ccaaaagaat ccgtgatgcc ggatcctggt gaggtgatgg aagctgtggt gatggctttg       780
     cgttctttgc gtgctaattg gatgcgcacc ctgctgacat tacttggcat tgttattggc       840
     gttggtgcgg tagtggtgat gttagcgatt ggtgagggcg caaaacagga tgtggtggca       900
     cagatcaatg agcgtggcac caatcttcta gtcgttcgcc cggaccgggg catgcaacga       960
     gtggcggatg gcgtgattgc caccttggtg ccagcggatg cgcaagcgtt agagtccctt      1020
     cctaatataa gcatcgcggt accggaaatt tctgggaatg tgactgcccg ggccaatggt      1080
     atggatatct cgaccagtgt gcaggcggtg agcgaagatt ttccatcgct acgtgattgg      1140
     cagcctgtgc agggaatatt tttcggggag gaggatctca agagctattc tccggtggct      1200
     gtgattggcc agacagtaaa agagaatcta tttccggagg gtgatccatt ggggcagttc      1260
     ctgttactcg acagtattcc ttttcaagta attggtgtga tgagcgctca gggcgccagt      1320
     gatcgggggg aggatcagga tgatgtggtc attgttccac tgtccaccgg aaccctgcgt      1380
     ttattcggac aaaactatct taactctatt acggtggcgg tggatgatgt gacgcaaatc      1440
     gatgccacgg aagccgctgc ggtggcgctg ttaacccagc gtcatggcaa gcaggatgtg      1500
     cgcgttttca acatggcctc gctgctggaa atggtgtcgg aaacccaaaa caccttaacg      1560
     gctctgctcg gttccattgc cgccatttcc ttgttagtcg gcggaatcgg agtgatgaat      1620
     atcatgttgg tgagtgtgac cgaacgtatc catgaaattg gtatccgtat ggctaccggg      1680
     gcaagacagc gcaatattct tcagcaattt cttaccgagt cggtggtggt atcggccttg      1740
     ggcggcattg ttggcgtagt gataggggta ttggtgggtt ggttattgat gctgtttggc      1800
     atggcgattg tgttctccgt gccggtgatg gtggtgtctt ttgtctgcgc tgcgggaatc      1860
     ggtttgttat ttggttttgc acctgcgttg aaggccgcgc gcctaaaccc agtggaggcg      1920
     ctcagtaatg attaa                                                       1935
//

If you have problems or comments...

PBIL Back to PBIL home page