(data stored in ACNUC7421 zone)

EMBL: AM286690.PE25

AM286690.PE25        Location/Qualifiers
FT   CDS_pept        complement(27828..28688)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0025"
FT                   /product="pirin family protein"
FT                   /function="unknown"
FT                   /note="conserved hypothetical protein identified by
FT                   sequence similarity; putative InterPro: DUF209"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15473"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTN5"
FT                   /protein_id="CAL15473.1"
FT                   /translation="MERSILNTFRAMDTSDGAGVKLKRALGYTPLMRLDPFLMLDAFSS
FT                   DNPDDYIAGFPPHPHRGFETVTYLVEGHMRHRDHLGNEGDLKQGGVQWMTAGSGIIHEE
FT                   MPQQENGLLRGFQLWINLPAAEKMKPATYRDIADTEMPRLDLASGGQIKAIAGEVTIAE
FT                   QTLSAPMKGGQTNPLYLDVVLRPRENLTVPLARGHNAFVYLFEGRIEVSGETVETHHLA
FT                   TLTDGDNVKLVARKRGARLLLLSGKPLGEPIVQYGPFVMNTQSEINQTLRDYRDGTLTA
FT                   QSSLL"
     atggaacgca gcattcttaa tacgtttcgc gcaatggata catccgatgg tgctggcgtt        60
     aagctgaagc gcgcactggg atatacccct ctcatgcgtt tggacccgtt tctgatgctc       120
     gatgcgtttt cctccgacaa tcccgacgat tatattgccg gctttccgcc gcatccgcat       180
     cggggatttg aaacggtgac ctatttggtg gaaggccata tgcgtcaccg agatcaccta       240
     ggaaacgaag gggatctcaa acagggtggc gtgcaatgga tgaccgctgg aagcggtatt       300
     atccatgaag aaatgccaca acaggaaaac ggtttgttac gcggttttca actgtggatt       360
     aacttgcccg cagcggaaaa aatgaagccg gcaacgtatc gagatattgc tgatacagag       420
     atgccgcggt tggatctggc cagtggtggg cagatcaaag ccattgccgg tgaagtgacg       480
     attgccgagc aaacgctcag tgctccgatg aaaggcggcc aaaccaaccc gttatatcta       540
     gatgtggtac tacgcccgag agaaaacctt accgtgccac tggcgcgggg ccataacgcc       600
     tttgtgtatc tgttcgaagg tcgcatagag gtgagcggag agaccgtgga aacccatcat       660
     ctagccacct tgaccgatgg tgataatgta aagctagtag caagaaaaag gggggcgcgt       720
     ctgttattgc tgtcaggcaa gccgctgggg gagccgatag tgcaatatgg ccccttcgtg       780
     atgaacactc aaagtgaaat taatcaaacc ctgcgggatt accgtgatgg aacgctgaca       840
     gcacagtcgt cgttgttata g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page