(data stored in ACNUC7421 zone)

EMBL: AM286690.PE255

AM286690.PE255       Location/Qualifiers
FT   CDS_pept        275353..275829
FT                   /transl_table=11
FT                   /locus_tag="ABO_0255"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15702"
FT                   /db_xref="InterPro:IPR012659"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSZ6"
FT                   /protein_id="CAL15702.1"
FT                   /translation="MPVSNKIKTDLWRFALGCWQDKAFENGCLHLQDEYQVPVSLLLCG
FT                   LWLAEAGKQPDARTGRRLAEVAEQFEADYLRPLRAVRRKAGQDDRLPEFKRQLQQVELE
FT                   GERWLLTTLPALCDNLLPAGKSVDPLSWLLVLVPEMAQCEGLQSALCRLVELKV"
     atgccagtga gtaataaaat aaaaacggat ctgtggcgtt ttgcgctggg gtgctggcag        60
     gacaaggcat tcgagaatgg ctgcctgcat ttgcaggatg aatatcaagt tccggtgtca       120
     ttactgctgt gtgggttatg gctggcggag gcgggaaagc agccggatgc ccgaaccggc       180
     cggcggttgg cagaagtggc cgagcaattc gaagcggatt atctgcgccc tttgcgcgcg       240
     gtgcgccgca aggctgggca ggatgaccgg ttgcccgagt tcaaacgcca actccagcaa       300
     gtggagctgg aaggtgagcg ttggttgctg actaccttgc ccgctttgtg cgataacctg       360
     ctaccggcag gcaaatcggt agacccgctg agctggttat tggtgttggt gccggaaatg       420
     gctcagtgcg aagggttgca gagcgcactt tgccgattgg ttgagttgaa agtttaa          477
//

If you have problems or comments...

PBIL Back to PBIL home page