(data stored in ACNUC7421 zone)

EMBL: AM286690.PE257

AM286690.PE257       Location/Qualifiers
FT   CDS_pept        277868..278206
FT                   /transl_table=11
FT                   /locus_tag="ABO_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15705"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSZ3"
FT                   /protein_id="CAL15705.1"
FT                   /translation="MRFGLIITVLLVAVLTALFTVPLGGGKPLLDWQHVERNWQQPEKL
FT                   FDGKVSPWLGKKDETELYRWRDPGGNWQYGQIPPPGVSVDPITVKAPSTISAEEMRGGK
FT                   GLETQQKQ"
     atgcgcttcg ggctcattat taccgtgctg ttggtagcgg tgcttacggc actgtttact        60
     gtgccgttag gtggaggcaa acctctactg gactggcaac atgttgagcg gaattggcaa       120
     cagccggaaa aactgttcga tggcaaagtg tcgccttggc tgggaaaaaa ggacgagact       180
     gagctgtatc gctggcgtga cccgggtgga aactggcagt atggccaaat tccaccgccg       240
     ggagtgtcgg tggaccccat tacagtgaag gctccaagca cgatcagcgc ggaagagatg       300
     cgcggtggca aggggcttga gacacaacag aaacaataa                              339
//

If you have problems or comments...

PBIL Back to PBIL home page