(data stored in ACNUC7421 zone)

EMBL: AM286690.PE264

AM286690.PE264       Location/Qualifiers
FT   CDS_pept        complement(283751..286123)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0264"
FT                   /product="S1 RNA binding domain protein"
FT                   /note="S1 RNA binding domain protein identified by match to
FT                   PFAM protein family HMMPF00575"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15712"
FT                   /db_xref="GOA:Q0VSY6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSY6"
FT                   /inference="protein motif:HMMPFAM:HMMPF00575"
FT                   /protein_id="CAL15712.1"
FT                   /translation="MRSIEQIIAEEIGCQERQVNAAVALLDEGSTVPFIARYRKEVTGG
FT                   LDDTQLRNLEERLRYLREMEERRETILKSITEQEKLTPELEKAIKAADTKTRLEDLYLP
FT                   YKPKRRTRAQIAREAGLEPLANSLIDDPTQDPEALAAGYLNEEHKIATAKDALDGAKQI
FT                   LMERFAEDAELLTRLRTFLWDKGQIQAKVVEGKEKDGAKFSDYFDHSETLKGIPSHRAL
FT                   ALFRGRNEGILHVSMVLPEELENAQPHPCEAMVTAVADWQHAGRAADDWLKEVMRWTWK
FT                   IKLNTHLETELLGRVREMGEEEAIQVFARNLKSLLMASPAGPKCTMGLDPGLRTGVKVV
FT                   VVDATGKLLEHTTIFPHQPKKQWDQSLSKLTALSKQHGVELIAIGNGTASRETDKLAGE
FT                   VVKLLKDQPIQKIIVSEAGASVYSASEMAALEFPELDVSFRGAVSIARRLQDPLAELVK
FT                   IDPKAIGVGQYQHDVSQVKLSRSLDTVVEDCVNSVGVDVNTASAPLLARIAGLNSTIAG
FT                   NIVSFREKNGAFASRANLKLVPRLGDKTFEQAAGFLRIMNGENPLDRSSVHPEAYPVVE
FT                   RIAEQHGRPLKDLVGDVPFLKKVNAADFTDDNFGLPTVTDILSELEKPGRDPRPEFKAA
FT                   VLKEGVETLKDLKQNMILEGTVTNVTNFGAFVDVGVHQDGLVHVSALADKFVEDPHQVV
FT                   APGDIVKVKVLDVDLDRKRISLTMRMGDQPTEKPSGQRPTSNRANQANKGNNPRRGGGN
FT                   GGAQRAGGQPQGGGGTFADLFAKAKEEKQKKDSKKRS"
     atgcgtagta tcgaacagat tattgccgaa gaaatcggtt gccaggaacg ccaggtcaac        60
     gctgccgttg ccctgctcga cgaaggttcc accgtcccct ttatcgcccg ttaccgcaaa       120
     gaggtgaccg gcgggctgga cgacacccag ctgcgcaacc tggaagaacg gctgcgttat       180
     ctgcgcgaga tggaagaacg ccgcgagacc atcctgaaga gcatcaccga acaggaaaag       240
     cttacccctg aactggaaaa agccatcaag gctgccgaca ccaagacccg gctggaagat       300
     ctctacctgc cctacaagcc caagcgccgt acccgcgccc agattgcccg cgaagctggc       360
     ctggaaccgc tggctaacag cctaatagat gatcctaccc aggacccgga agcactagcc       420
     gccggttact tgaacgagga acacaagatt gccaccgcca aggacgcctt ggacggtgcc       480
     aaacagatcc tcatggagcg tttcgctgaa gatgccgagc tgctcacccg cctgcgcacc       540
     ttcctctggg acaaaggcca aattcaggcc aaagtggtgg aaggcaagga aaaagacggc       600
     gccaagttca gtgactattt tgatcacagc gaaaccctca aagggatccc cagccaccgc       660
     gcactggccc tgtttcgggg ccgtaatgag ggcattttgc atgtctcaat ggtgctgccg       720
     gaagagttgg aaaatgctca accgcatccc tgcgaagcca tggtcactgc cgtagcggac       780
     tggcagcacg ccggccgggc cgccgatgat tggctcaaag aagtgatgcg ctggacctgg       840
     aagatcaaac tcaacactca tctggaaacc gaattactgg gccgagtgcg tgaaatgggt       900
     gaagaggaag ccattcaggt tttcgctcgt aacctgaaaa gcttgttgat ggcctccccc       960
     gccggcccta aatgcaccat gggcctggac cctggcctgc gtaccggcgt gaaagtggtt      1020
     gtcgtggatg ccaccggaaa gctgctggaa cacaccacca tcttccctca ccagccaaag      1080
     aagcagtggg atcagtccct cagtaagctg actgcgctga gcaaacagca tggcgtggaa      1140
     ttgatcgcca tcggcaacgg cactgctagc cgggaaaccg acaagctggc cggcgaagtg      1200
     gtgaaattgc tcaaggatca gccgatccaa aaaattatcg tttctgaagc cggcgcctcg      1260
     gtctactctg cctcggaaat ggcggccctg gaattcccag aactagacgt gtctttccgt      1320
     ggcgcggtat ccattgcccg ccgcctgcaa gacccactag ccgagttggt aaaaatcgat      1380
     ccgaaagcca tcggtgttgg ccagtaccag catgacgtaa gccaggtaaa attgtcccgc      1440
     tcactggata ccgtggtgga agactgcgtg aactcggtgg gcgtggatgt gaacaccgcc      1500
     agcgccccct tgctggcccg tattgccggc cttaacagca ccatcgccgg caacatcgtt      1560
     tcgtttcgag agaagaacgg cgcctttgcc agccgcgcca acctgaaact ggtgccgcgc      1620
     ctaggcgaca agacctttga gcaagccgct ggtttcttgc gcatcatgaa cggcgaaaac      1680
     ccgctggacc gctcctcggt tcacccagaa gcctacccgg tggtggaaag aattgccgag      1740
     cagcatggcc gccccctaaa ggatctagtg ggtgatgtgc cgttcctgaa gaaggtcaac      1800
     gctgccgact tcaccgacga taacttcggc ttacccaccg tcaccgacat tctcagtgaa      1860
     ttagaaaaac ccggccgcga tccgcgcccg gaattcaaag ccgcggttct caaggaaggg      1920
     gtggaaaccc tcaaggatct caagcaaaac atgatcctcg aaggcaccgt caccaacgtg      1980
     accaacttcg gcgcctttgt agatgtgggt gttcatcagg acggactggt gcacgtatcc      2040
     gcactggccg acaaattcgt ggaagatccg caccaagtgg tcgcccccgg cgatatcgtt      2100
     aaagtgaaag tgctggacgt ggatctagac cgcaaacgca tcagcctgac catgcgcatg      2160
     ggcgatcaac ccacggagaa acccagcggc caacgcccca ccagcaaccg cgccaaccaa      2220
     gcaaacaaag gcaataaccc acgccgtggc ggtggtaatg gtggagctca acgcgctggc      2280
     ggccagcccc agggcggcgg cggcaccttc gccgacctat ttgccaaagc taaggaagag      2340
     aagcagaaga aagacagcaa gaagcgctcc tga                                   2373
//

If you have problems or comments...

PBIL Back to PBIL home page