(data stored in ACNUC7421 zone)

EMBL: AM286690.PE271

AM286690.PE271       Location/Qualifiers
FT   CDS_pept        295758..296408
FT                   /transl_table=11
FT                   /locus_tag="ABO_0271"
FT                   /product="potassium uptake protein TrkA"
FT                   /note="(trkA) identified by match to PFAM protein family
FT                   HMMPF02080 InterPro: KTN NAD-binding domain"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15719"
FT                   /db_xref="GOA:Q0VSX9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSX9"
FT                   /inference="protein motif:HMMPFAM:HMMPF02080"
FT                   /protein_id="CAL15719.1"
FT                   /translation="MKHQYAVIGLGSFGSTIAQELTRLGHDVMGVDIDGERVECYADKL
FT                   SQTLIADGTNDKVIAELEMTAFDAVVVAIGENLEASILTTLALKSAEVEQVWVKAISEP
FT                   HHRILSRLGANRIIHPEHEMGIRVAQTIVHPEMLDYISLGNDWLVVEVKVDKRFAGKAA
FT                   SELPLGDDELRLALVKRGTQVWQSPFEDLLLQERDQLVLMGTLNDLLRFSKAQ"
     gtgaagcatc agtatgctgt gatcggtttg ggcagttttg gttcgaccat tgcgcaggag        60
     cttacccgct tgggccatga tgtgatgggg gtggatatcg atggggaacg ggtggagtgt       120
     tatgccgaca aattgtcaca gactctgatt gccgacggta ccaatgacaa ggtgattgcc       180
     gagctggaga tgacggcttt tgatgcggtt gtggtggcca ttggtgagaa cctggaggcc       240
     agcattctta ctactttagc gttaaaaagt gcggaggtgg agcaggtgtg ggtgaaagcg       300
     atcagcgagc ctcaccaccg gatcttgtcg cggctgggcg ccaaccggat cattcatcct       360
     gagcatgaaa tgggtattcg ggttgcccag actatcgttc acccggaaat gctcgactat       420
     atctccttag ggaatgactg gttggtggtt gaggtcaagg tggataagcg atttgcgggc       480
     aaggccgcgt ctgaattgcc tttgggcgat gatgagctgc gcttggcgct agtcaagcga       540
     gggacccagg tctggcagtc gccctttgaa gacttactgt tgcaagagag ggatcagttg       600
     gtgctgatgg gcacattgaa cgacctgctg cggttttcta aagcgcaatg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page