(data stored in ACNUC7421 zone)

EMBL: AM286690.PE281

AM286690.PE281       Location/Qualifiers
FT   CDS_pept        305911..306798
FT                   /transl_table=11
FT                   /locus_tag="ABO_0281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15729"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSW9"
FT                   /protein_id="CAL15729.1"
FT                   /translation="MSAMRELRFVSDGQSCRGDLYLPEGEGPFLTVVMGHGFGLTKECG
FT                   LAPFRDAFVQAGYAVFLFDYRHFGESEGMPRQVLLPYREVADWQAALACVRKLAEVDNQ
FT                   RIVLWGTSFGGGLVTVVAAREPVAGIIAQCPMMDGMASVLEVIRYAGVGQALKMTGIGL
FT                   WDLASSALGLGPKMLPSAGRPGELAAMSSDDAYDGYTALMPAHVPNEVAGRVALALPLF
FT                   RPVAQASKVTCPALILICETDTVAPASAAEKAAAAMARASVKRYPVGHFDVYQGEAREI
FT                   SLADQLAFLRDVES"
     atgagtgcaa tgcgtgaatt acgtttcgtt agtgacgggc aatcctgccg gggcgatctg        60
     tatttgcctg aaggcgaggg gccttttctg acagtggtca tgggccacgg ttttgggctt       120
     accaaggaat gcgggttggc accgtttcgc gacgcttttg tacaggccgg ttatgccgtg       180
     ttcctattcg attaccgcca ttttggtgaa agcgaaggaa tgccccgcca ggtgttgttg       240
     ccctatcggg aggtggctga ttggcaggcg gcgctggcct gtgtgcgcaa gctagctgaa       300
     gtggataacc agcgcatcgt tttgtggggt acctcctttg gtggtggttt ggtcactgtg       360
     gtggcggccc gggagccggt ggcgggtatt attgcgcagt gtccgatgat ggacggcatg       420
     gcgtcagtgt tggaggtgat tcgttatgcg ggtgtggggc aggcgttgaa gatgaccggt       480
     attggtctgt gggacctggc cagcagtgca ttggggctgg ggcctaaaat gttgccctcg       540
     gcagggcgcc ccggtgagct ggcggctatg tccagcgatg acgcttatga tgggtacacc       600
     gcgttgatgc cggcccacgt gcctaacgag gtggccgggc gggttgcgct ggcgctgccg       660
     ctatttcggc ctgtggccca ggccagtaag gtcacttgcc cggcgctgat ccttatttgc       720
     gaaaccgata cggtggcgcc ggcatcggcg gcagaaaaag cggctgcagc gatggctcga       780
     gccagcgtga aacgttatcc ggtgggacat tttgatgtct accaaggcga ggcccgggag       840
     atcagcctgg cggatcagtt ggcgtttttg cgggatgttg aaagctaa                    888
//

If you have problems or comments...

PBIL Back to PBIL home page