(data stored in ACNUC7421 zone)

EMBL: AM286690.PE283

AM286690.PE283       Location/Qualifiers
FT   CDS_pept        complement(309077..310042)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0283"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15731"
FT                   /db_xref="GOA:Q0VSW7"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSW7"
FT                   /protein_id="CAL15731.1"
FT                   /translation="MALPASLQNSLQLPVVASPMFIVSNPELVIAQCKAGIVGSFPALN
FT                   ARPAEELEVWLKRITEELDAWNQANPDKPAAPFAVNQIVHRSNNRLEHDLELCVKYKVP
FT                   IVITSLGARVDVNEAIHSYGGLVFHDIINNFFAKKAIEKGADGLIAVAAGAGGHAGTLS
FT                   PLALVQEIREWFDGPLLLSGAIATGDAVLAAQAMGADLGYIGSAFIATDEANADERYKQ
FT                   AIVDSGASDIVYSNLFTGVHGNYLRGSIEAAGLDPENLPESDPSKMDFGDGSSKAWKDI
FT                   WGSGQGIGAVKKIGPAADLVDRLKREYSAARQRINALPWK"
     atggccctac ctgcctccct gcaaaacagc ctgcagctac ccgttgtggc atcccccatg        60
     ttcattgtgt ccaacccgga gctggtgatc gcccagtgca aagccggcat tgtcggctct       120
     tttcccgccc tgaacgctcg tcccgcagaa gagctggaag tatggctcaa gcgcattacc       180
     gaagagctcg atgcctggaa ccaggccaac cctgacaagc ctgcggcccc attcgcggta       240
     aaccagattg tgcacagatc caacaatcgg ctggagcatg atctggagct atgtgtgaag       300
     tacaaggtgc ctatcgtaat aacctcactg ggcgcacgag tggatgtgaa cgaagccatt       360
     catagttatg gcggactggt attccacgac atcatcaata acttcttcgc caaaaaagcc       420
     atagagaaag gtgctgatgg cctgatcgct gtggccgctg gcgcgggcgg ccatgcaggc       480
     accctctccc cgctggccct ggtgcaggaa attcgtgagt ggttcgacgg gccactgctg       540
     ctctccggtg cgatcgccac cggggacgcc gttctcgctg ctcaggccat gggcgcagac       600
     ttgggctata tcggctccgc ctttattgcc accgatgaag cgaatgcgga tgagcgctac       660
     aaacaagcca ttgtggacag cggcgccagc gacattgttt attccaacct attcactggc       720
     gtgcacggta actacctgcg cgggtccatc gaagccgcgg gtctggatcc ggagaaccta       780
     ccggaaagcg atccgtcaaa aatggacttc ggcgatggca gctccaaagc ctggaaagac       840
     atctggggta gcggtcaggg tatcggtgcg gtgaagaaaa taggcccagc agcagatctg       900
     gtcgaccgcc tgaagcgaga atactcagcc gcacgccaac ggattaatgc tttaccttgg       960
     aaatag                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page