(data stored in ACNUC7421 zone)

EMBL: AM286690.PE284

AM286690.PE284       Location/Qualifiers
FT   CDS_pept        complement(310198..310692)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15732"
FT                   /db_xref="GOA:Q0VSW6"
FT                   /db_xref="InterPro:IPR025557"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSW6"
FT                   /protein_id="CAL15732.1"
FT                   /translation="MQTPKSETPPPGPPPRIPNLADWRFNRYLTMQLMPLFYLLLIAGA
FT                   LIVVVSVVGLCFWFSTLAGIIAAVIAPLAFVVMVAVIRAALEYMIMAHRIMRIIERMDA
FT                   LPGQVADLSVRVDGITNHVDELSGHVTDIHETLMHARPLLRSAGLPSRLLNALRRRTPD
FT                   A"
     atgcagacac ccaagtcgga aacgccacca cctgggccgc cccctcgtat tcccaacctg        60
     gcggattggc gtttcaaccg ctatctgacc atgcagctga tgccgctgtt ctatcttctg       120
     ctgattgctg gcgcactgat tgtggtcgtt agcgtagttg gcttgtgctt ttggttctct       180
     acgctggccg gcattattgc cgccgttatt gcaccacttg cctttgtggt aatggtggcg       240
     gtgatccgcg cggcactgga atacatgatt atggcccacc gcatcatgcg catcatcgaa       300
     cgcatggacg ccctccccgg ccaggtagca gacttatcag tacgtgttga cggcattacc       360
     aatcatgtag acgaattgag cgggcatgta accgatatcc atgaaacact gatgcacgcc       420
     cgcccgttgc tacgctccgc gggcttaccc agccgcctgc tcaatgcatt gcggcgccga       480
     acgcctgacg cctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page