(data stored in ACNUC7421 zone)

EMBL: AM286690.PE288

AM286690.PE288       Location/Qualifiers
FT   CDS_pept        313366..314919
FT                   /transl_table=11
FT                   /locus_tag="ABO_0288"
FT                   /product="monooxygenase"
FT                   /EC_number="1.14.13.-"
FT                   /note="monooxygenase flavin-binding family identified by
FT                   sequence similarity; putative InterPro: Flavin-containing
FT                   monooxygenase (FMO)"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15736"
FT                   /db_xref="GOA:Q0VSW2"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSW2"
FT                   /protein_id="CAL15736.1"
FT                   /translation="MTASPTSPKKAVRKSASRQRSSSTKEPAVTKTPVIKPASVLIVGA
FT                   GFAGLGMAIRLKQAGIEDIVILERANAVGGTWRDNQYPGAACDVPSNLYSYSFAPNPNW
FT                   SRSFSGSEEILGYIQHLVAEFELESYIRFEKNVQELSFDEKKGIWTATTDKGEQFAGRA
FT                   AVMAQGPLSNCSFPAITGIEDFKGHKIHSARWDHEYDFTGKKVAVIGTGASGIQIIPEL
FT                   VKQAAHVKVFQRTPGWVLPRPDFVTPAWNKALFRKLPASQQAMRNLLFWTHESMALAVI
FT                   WNSPLTRVAERVAKMHLRRQVKDRWLRRQLTPDFTIGCKRVLVSNDYYPALQKDNAKLI
FT                   TWPIARLSEKGIRTVEGIEHQADCIVFATGFDVSHSGTPFPVKGRKGRVLGDEWQGGAQ
FT                   AYKSINVSGYPNLYMTFGPNSGPGHNSALVYMESQLDYAVKGVQKILQEDLKMLDVKKD
FT                   VQRKHNQAMQKRLAKTNWNSGCKSWYLTEDGFNATMYPGFATQYAAQMAAFEENDYETV
FT                   "
     atgactgcat cccctacttc ccctaaaaag gccgttcgca aatcggcttc ccgtcagcgt        60
     tcttcctcaa cgaaagagcc ggcggtaaca aaaacaccag tgataaaacc ggcctcggtc       120
     ctgattgtgg gcgcggggtt tgccggccta gggatggcca ttcgtctcaa gcaggccggt       180
     attgaggata tcgtgattct ggaacgagcc aacgcggtgg gcggcacctg gcgagacaat       240
     caataccctg gggccgcttg cgacgttccc tccaatctct attcgtattc ttttgcgccc       300
     aacccgaact ggtcacggag cttctcgggc agcgaagaaa tcctgggtta tatccagcat       360
     ctggtggctg agttcgagtt ggagtcgtac attcgtttcg agaaaaacgt gcaagagctg       420
     tcttttgatg aaaagaaagg catctggacc gccacgacgg ataaggggga gcagtttgct       480
     gggcgggccg cagtgatggc tcaggggccc ttgtcgaact gcagtttccc ggcgattact       540
     ggtattgagg atttcaaggg ccacaagatt cacagcgccc gctgggatca tgagtacgat       600
     tttaccggca agaaagtggc tgtcattggt accggtgcca gcggtatcca aatcattccc       660
     gaactggtca aacaggcggc ccacgtgaag gtgtttcagc gcactccggg ctgggttctg       720
     ccgcgtcctg attttgtcac tccggcctgg aacaaagccc tttttcgcaa gttgccggcc       780
     agccagcagg ccatgcgtaa tcttctcttc tggacccatg aaagcatggc gctggcggta       840
     atatggaact cgccgctgac ccgcgttgct gaacgggtag cgaagatgca tctacgccgg       900
     caagtgaaag accgctggtt gcgtcgtcag ttgaccccgg atttcaccat cggctgcaag       960
     cgggtgttgg tctccaatga ttattaccct gcgttgcaaa aagacaatgc caaactgatt      1020
     acctggccca ttgctcgcct tagtgaaaaa gggattcgta cggtagaagg tattgagcat      1080
     caggccgact gcatcgtgtt tgctacgggc ttcgatgtca gccattccgg cacgcctttc      1140
     cccgttaaag ggcgtaaggg tcgggtgttg ggtgacgagt ggcaaggcgg tgcccaggcc      1200
     tacaagagca ttaatgtgtc cggttatccc aatctctata tgacctttgg gcctaattct      1260
     gggcccggtc ataattccgc cctggtgtat atggagtccc agcttgatta cgcggtgaaa      1320
     ggggtgcaga aaattcttca ggaagacctg aagatgctgg atgtgaaaaa agatgttcag      1380
     cgtaagcaca accaggccat gcagaaacgg ctggcaaaaa ctaactggaa ttcaggttgc      1440
     aagagctggt atctcaccga agacggcttc aatgccacca tgtacccagg gtttgccact      1500
     cagtacgcgg cacagatggc cgcttttgaa gagaacgatt acgaaaccgt ctga            1554
//

If you have problems or comments...

PBIL Back to PBIL home page