(data stored in ACNUC7421 zone)

EMBL: AM286690.PE29

AM286690.PE29        Location/Qualifiers
FT   CDS_pept        31494..32021
FT                   /transl_table=11
FT                   /locus_tag="ABO_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15477"
FT                   /db_xref="InterPro:IPR025411"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTN1"
FT                   /protein_id="CAL15477.1"
FT                   /translation="MQRLMIPRFLVLASALLLSACVSPVVIDSQPDANLAQYQTYAFVS
FT                   QAEDGPRELDDQRTLAALEKALAAEGMTEVDADQADVQVKYFFKREQRFDGSSVQFGFG
FT                   FTRNNVGLGASTPTEGEISDEYKLVVQLIDPQNRNVVWQATSRDKMHDEMSSERRNTYI
FT                   QKAVEEMFKQYP"
     atgcaacgtt taatgattcc gagatttctg gtgctggcct cagccttgtt gctcagtgcc        60
     tgcgttagcc cggtggtaat cgacagccag ccggacgcga atcttgccca ataccagact       120
     tacgcctttg tttcccaggc tgaagacggt ccccgcgagc tggatgatca acgcactctg       180
     gctgcgctgg aaaaagcgct ggcggcggag ggaatgaccg aggtcgatgc agaccaagcg       240
     gatgtgcagg tgaaatactt tttcaagcgt gagcagcgct ttgatggttc ctccgttcaa       300
     tttgggtttg gttttacccg taacaatgtg gggttgggag cctccactcc cacagaaggc       360
     gagattagcg acgaatacaa gctggtagtg cagttgattg atcctcagaa ccgcaatgta       420
     gtgtggcagg caaccagccg tgacaaaatg catgatgaga tgagcagtga gcgtcgcaat       480
     acgtatattc aaaaagcggt agaggaaatg ttcaagcagt atccgtaa                    528
//

If you have problems or comments...

PBIL Back to PBIL home page