(data stored in ACNUC7421 zone)

EMBL: AM286690.PE291

AM286690.PE291       Location/Qualifiers
FT   CDS_pept        complement(317609..319282)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0291"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="ABC transporter ATP-binding protein identified by
FT                   sequencesimilarity; putative InterPro: AAA ATPase
FT                   superfamily belongs to the abc transporter family. ef3
FT                   subfamily"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15739"
FT                   /db_xref="GOA:Q0VSV9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSV9"
FT                   /protein_id="CAL15739.1"
FT                   /translation="MPPLSPRRLLRVLRSRRWRAPAALSLQDSPLISTANITMQFGAKP
FT                   LFENVSVKFGNGNRYGLIGANGCGKSTFMKILGGELQPSNGQVMLDSNDRLGKLRQDQF
FT                   AFEEYTVLDTVIMGHTELATVKAERDRIYSLPEMSEEDGMRVAELEMQFAEMDGYTAEA
FT                   RAGDLLLGLGIPEEQHAGPMTAVAPGWKLRVLLAQALFSDPDVLLLDEPTNHLDIHTIR
FT                   WLEDILVARSSTMIIISHDRHFLNSVCTHMADLDYGELRLFPGNYDEYMTAATAARDRL
FT                   YADNAKKKKEIADLQSFVSRFSANASKAKQATSRAKQIDKIQLEEVKPSSRISPYIRFE
FT                   QSKKLHRQAVTLEGLGKHYDDLTLFQDLSLQVEAGERVAIIGPNGIGKTTLLRCLAGDL
FT                   TADTGTVKWAEAADLGYFAQDHSHDFEQDMILFDWMAQWTSDGEQAVRAALGRMLFSND
FT                   EVMKSVKVISGGEQGRMLFGKLTLTQPNVLLLDEPTNHLDMESIEALNLALENYPGTLF
FT                   FVSHDREFVSSLATRILEITPDGVRDFTGSYDDYLKSIEA"
     atgccgcctc tttctccccg ccggttgctg agagtactcc gcagccgtcg atggcgtgcc        60
     cccgccgctc tctcgttaca ggatagtcct ttgatttcta ccgcgaacat cactatgcag       120
     ttcggcgcca agccactgtt tgaaaacgtt tccgtcaaat tcggcaacgg caaccgttac       180
     ggcctaatcg gcgccaacgg ctgcggcaaa tccaccttca tgaagattct cggtggcgaa       240
     ctgcagccca gcaatggtca ggtcatgctg gattccaatg atcgccttgg gaaattgcgc       300
     caggaccagt tcgccttcga agaatacacg gttctggaca ccgtgatcat ggggcatacc       360
     gagctggcca cggtaaaagc cgaacgcgac cgtatctaca gcctgccgga aatgagcgaa       420
     gaagacggca tgcgcgtggc ggaactggag atgcagttcg cagaaatgga cggttacacc       480
     gccgaagccc gtgccgggga tctgctgttg ggccttggca ttcccgagga gcaacacgcg       540
     ggcccgatga ccgcagtggc ccccggctgg aaactgcgcg tgctgctcgc ccaagcgctg       600
     ttttccgatc cggacgtatt gctgcttgat gagcccacta accacttgga catccatact       660
     attcgctggc tggaagatat tttggtggcc cgttctagca ccatgattat tatctcccac       720
     gatcgccact tcctgaacag tgtatgcacc cacatggcgg atctcgatta cggtgaactc       780
     cgcttgttcc ccggtaacta cgacgagtat atgaccgccg ccaccgccgc ccgtgatcgg       840
     ctgtatgcag ataacgccaa gaagaaaaaa gaaattgctg acctgcaaag ctttgttagt       900
     cgcttctcgg ctaatgcctc caaggccaaa caggccacca gccgggccaa gcaaatcgac       960
     aagatccagc tggaagaggt aaagccctcc agccgcatta gcccctacat tcgttttgaa      1020
     caaagcaaaa aactacaccg ccaagcggta accctagaag ggctcggcaa gcattacgat      1080
     gacctgaccc tattccagga cctgagcctg caagtagagg ccggcgaacg ggtagccatt      1140
     atcggcccta acggcatcgg taagaccacc ctgctgcgct gcctggccgg cgacctgacc      1200
     gcagataccg gcaccgtaaa atgggcggaa gccgccgacc tcggttactt cgctcaagac      1260
     cacagccatg actttgaaca ggacatgatc ctgttcgact ggatggccca atggaccagc      1320
     gatggcgagc aggcagtccg tgcggcgctt ggccgcatgc tgttttccaa cgacgaagta      1380
     atgaaatccg tgaaggtgat ttccggggga gaacaaggcc gcatgctgtt cggcaagctg      1440
     acgctgactc agcccaatgt cttgttactg gacgaaccca ccaaccatct ggacatggaa      1500
     tccatcgaag cgctcaacct agcgctggag aactacccag gcacactgtt ctttgtcagc      1560
     cacgaccggg aattcgtcag ctccttggcc acccgcattc tggaaatcac cccggacgga      1620
     gtgcgcgatt tcaccggcag ttacgatgat tatctgaaga gcattgaggc ctga            1674
//

If you have problems or comments...

PBIL Back to PBIL home page