(data stored in ACNUC7421 zone)

EMBL: AM286690.PE293

AM286690.PE293       Location/Qualifiers
FT   CDS_pept        320221..320676
FT                   /transl_table=11
FT                   /locus_tag="ABO_0293"
FT                   /product="conserved hypothetical protein"
FT                   /function="unknown"
FT                   /note="(conserved hypothetical protein )"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15741"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSV7"
FT                   /protein_id="CAL15741.1"
FT                   /translation="MGGYGYHGGFFPVLDSAMFEQTITPRFYETDAFGHVNNTVVTGWF
FT                   ETGRAPLFRLFGDAENPASMPLILARVEVDFVAQIYYGSDVILRAAIERIGNSSFVVIQ
FT                   QAWQNGALVARGRAVQVYFDHKTQASAPLPDDLRDALAQHEGELPES"
     atgggaggct atgggtatca tggcggcttc tttcctgtat tggattcagc catgtttgaa        60
     caaaccatta ccccccgctt ttacgagacc gatgcttttg gccatgtgaa taatacggtt       120
     gtcactggtt ggtttgaaac cggtcgtgcg ccgttgtttc ggcttttcgg tgacgcggaa       180
     aatccagcat caatgccgtt gattctcgcc cgagtggagg tcgattttgt cgctcagatt       240
     tactatggca gtgacgtgat cctgcgtgca gctattgagc gcattggcaa cagctccttt       300
     gtggtgattc agcaggcatg gcagaacggg gctctggtgg ccagagggcg ggccgttcag       360
     gtgtattttg accacaagac gcaggcctca gcgccgctgc ccgatgatct ccgtgacgct       420
     ttagcccagc acgaaggcga gctaccagaa agctaa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page