(data stored in ACNUC7421 zone)

EMBL: AM286690.PE297

AM286690.PE297       Location/Qualifiers
FT   CDS_pept        324130..325128
FT                   /transl_table=11
FT                   /locus_tag="ABO_0297"
FT                   /product="ABC transporter, ATP-binding protein, putative"
FT                   /note="(ABC transporter ATP-binding protein, putative)
FT                   identified by match to PFAM protein family HMMPF00005
FT                   InterPro: AAA ATPase superfamily"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15745"
FT                   /db_xref="GOA:Q0VSV3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSV3"
FT                   /inference="protein motif:HMMPFAM:HMMPF00005"
FT                   /protein_id="CAL15745.1"
FT                   /translation="MRVDAVVSIKNLHKTYQSGFQALKGVDLDIRAGEIFALLGPNGAG
FT                   KTTLISIICGIVNPSSGTVRAAGHDIISEFRAARSAIGLVPQEISTDAFETVWATVSFS
FT                   RGLFGKPRNDAHIEKVLKALSLWDKKDSKIITLSGGMKRRVMIAKALSHEPRILFLDEP
FT                   TAGVDVELRREMWEMVRQLREQGVTIILTTHYIEEAEEMADRVGIISKGEIILVDEKSR
FT                   LMEKLGRKQLIVHLSEPLTAVPDVLAGQELALADEGFSLVYSYDANQENTGIAELLRHL
FT                   NEQGIDFKDLHSRQSSLEDIFVDLVHNGKPGASPVSNGATSEKPNVPGDEK"
     atgcgtgtgg atgcagtggt ttcgatcaag aacctgcaca agacttatca atccgggttt        60
     caggcgctca aaggcgtgga tctggatatt cgcgctggcg agatctttgc cttgctgggg       120
     cccaatggtg cgggcaaaac cacgctgatc agtattattt gcggtattgt taatccttct       180
     tcgggtacgg tgcgggccgc aggccatgac atcatttccg aatttcgtgc cgcaagaagt       240
     gccattgggt tggtgcctca ggaaatttcc acggatgcct tcgaaacagt ttgggcaacg       300
     gtgagtttta gtcgtggcct ttttggaaaa ccgcgcaatg atgcccatat cgaaaaagtg       360
     ttaaaggcat tgtctctgtg ggacaagaaa gacagcaaga tcatcacgtt gtccggtggc       420
     atgaaacgtc gggtgatgat agccaaggcg ctgtcccatg aacccagaat tttgtttctt       480
     gatgagccca ccgcgggcgt ggacgtggag ttgcgacgtg aaatgtggga aatggtacgt       540
     cagcttcgtg agcaaggagt cactatcatc ctgactaccc actacattga agaggccgag       600
     gaaatggccg accgagtggg gattatcagc aagggtgaaa ttattctagt ggatgaaaaa       660
     tcgcgcctga tggagaagct aggccgcaaa cagctgatcg tgcatctgtc tgagccattg       720
     acggcagtgc cggatgtgtt ggcagggcag gaactggcgt tggccgatga aggcttctca       780
     ctggtgtata gctacgatgc caaccaggaa aacaccggca ttgccgaact gctacgtcac       840
     ctgaacgagc agggtatcga tttcaaagac ctgcactcac gacaaagttc gctggaagat       900
     atttttgtgg atctagttca taacggtaag cctggcgcta gcccggtttc gaatggagcc       960
     accagtgaaa aacccaatgt accgggggat gaaaaatga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page