(data stored in ACNUC7421 zone)

EMBL: AM286690.PE298

AM286690.PE298       Location/Qualifiers
FT   CDS_pept        325125..325886
FT                   /transl_table=11
FT                   /locus_tag="ABO_0298"
FT                   /product="ATP-binding cassette (ABC) transporters,
FT                   permease, putative"
FT                   /function="responsible for the controlled efflux and influx
FT                   of substances (allocrites) across cellular membranes."
FT                   /note="(ATP-binding cassette (ABC) transporters, permease
FT                   protein, putative) identified by match to PFAM protein
FT                   family HMMPF04306 InterPro: ABC 2 transport system integral
FT                   membrane protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15746"
FT                   /db_xref="GOA:Q0VSV2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSV2"
FT                   /inference="protein motif:HMMPFAM:HMMPF04306"
FT                   /protein_id="CAL15746.1"
FT                   /translation="MNIHSIRAIYKFEMARTWRTLMQSVASPVISTSLYFVVFGSAIGS
FT                   RMVEIDGVSYGAFIIPGLIMLSLMTQSISNASFGIYMPTFSGTIYEVLSAPVSYVEIVI
FT                   GYVGAAATKSTILGLLILLTARLFVDYDVQHPLLMISFLLLTAVTFSLFGFVIGVWADT
FT                   FEKLQIIPLMIITPLTFLGGSFYSIDMLPPVWQTVTLFNPVVYLISGFRYSFFGVADVH
FT                   IGVSLGMTLFFLTLCMGLVWWIFKTGYKLKS"
     atgaatattc actccattcg cgcgatttac aaattcgaga tggcgcgaac ctggcgtact        60
     ctgatgcaga gtgttgcatc accagtgatc tccacatcgt tgtattttgt ggtgttcggg       120
     tccgccatcg gttcacgtat ggtcgagatt gatggtgtta gttatggcgc gtttattatt       180
     cctgggctga tcatgttgtc tctgatgacg cagagtattt ccaacgcgtc ttttggtata       240
     tacatgccca ccttttccgg caccatttat gaagtgttat ctgctcctgt gtcctatgtg       300
     gagattgtga tcggctatgt gggggctgcg gctaccaagt cgacgattct ggggttgctt       360
     attcttctta ccgctcgatt atttgtggat tatgacgtgc aacatccact tttaatgatc       420
     agttttctgt tgcttacggc agtgacgttc agtttgtttg gctttgttat cggggtgtgg       480
     gcagatacgt ttgagaagtt gcagatcatt cctttgatga ttattacacc gctgaccttc       540
     ctggggggca gtttctattc catcgatatg ttgccgccgg tctggcagac ggtgactttg       600
     ttcaatccgg ttgtctattt gattagtgga ttccgttaca gctttttcgg cgtcgccgat       660
     gtacacattg gtgttagctt gggtatgacg ttgtttttcc tgaccctgtg catggggctg       720
     gtgtggtgga ttttcaaaac cggttataaa ttgaagagct aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page