(data stored in ACNUC7421 zone)

EMBL: AM286690.PE299

AM286690.PE299       Location/Qualifiers
FT   CDS_pept        325950..326897
FT                   /transl_table=11
FT                   /locus_tag="ABO_0299"
FT                   /product="conserved hypothetical protein"
FT                   /note="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15747"
FT                   /db_xref="GOA:Q0VSV1"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSV1"
FT                   /protein_id="CAL15747.1"
FT                   /translation="MAPAPTFLRITTMIVRERPNAIALLLALRGSVVPEILPHIAFVAL
FT                   FSVAVAALSHYQLIGLQSLTIMPVTLLGIVLSILLGFRNNASYDRWWEARKQWGQMVNE
FT                   IRSLARVSGALLGEDAPARRAILMRALAYAHALKGQLREENVGEDLLAWVSREDCDLAL
FT                   ATANPADAFIAQAGSLLGEQYRQGSLDSMGLRMLDERLAALSKVQAASERIATTPLPFA
FT                   YTLLVHRTAYVYCYLLPFVLTGSMGWVSPILTAVVAYTFFGIDRLSEHLETPFGRAPND
FT                   LPLDALCRIHEISVADALGDVAPAPLPVKNFQLQ"
     ttggcgccag ccccgacatt tctgcggatt actaccatga tcgttcgaga gcgtcctaac        60
     gctattgccc tattgcttgc cctgcgaggc tcggtagtgc cggaaatttt gccgcatatt       120
     gcctttgttg cgttgttttc cgtggcggtt gcagcgctta gccactatca gctgattggt       180
     ttgcaaagtc tgactatcat gccggtgacc ctgcttggaa tcgttttgtc gattctgctt       240
     ggttttcgca acaatgcctc ttatgaccgg tggtgggaag ccaggaagca gtgggggcag       300
     atggttaatg aaatacgcag cctggctcgg gttagcggtg cgctgctagg ggaagatgcg       360
     cctgcccggc gagctatact gatgagggcc cttgcctatg cccacgccct gaaagggcag       420
     ctacgggaag aaaatgttgg cgaggatttg ttggcctggg tgtcgcgtga agactgtgat       480
     ctagcattgg caaccgcgaa tcccgccgat gcctttatcg cacaggctgg cagcctgctg       540
     ggtgagcagt atcgtcaggg ctcgttggat agtatgggtt tgaggatgct tgatgagcgt       600
     ttggccgcgc tgagtaaggt tcaggctgcc agcgaacgaa ttgcgactac gcctctgccg       660
     tttgcctata ccttgttggt tcaccgtaca gcctatgtct attgctacct gttgcctttc       720
     gtattgactg gaagcatggg atgggtgtca cccattctca ccgccgtcgt agcctatacc       780
     ttcttcggta ttgatcgcct ttctgagcac ctagaaaccc cgttcgggcg tgcccctaat       840
     gacctgccgt tggatgcctt gtgtcgtatc catgagattt ccgttgcgga cgcgttgggg       900
     gatgttgcac ccgcgccctt accggtaaag aactttcagc tccagtaa                    948
//

If you have problems or comments...

PBIL Back to PBIL home page