(data stored in ACNUC7421 zone)

EMBL: AM286690.PE30

AM286690.PE30        Location/Qualifiers
FT   CDS_pept        complement(32005..33318)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0030"
FT                   /product="sensor histidine kinase"
FT                   /function="activates the flagella regulon by activating
FT                   transcription of flhdc. may activate qseb by
FT                   phosphorylation"
FT                   /EC_number="2.7.3.-"
FT                   /note="sensor histidine kinase identified by sequence
FT                   similarity; putative InterPro: Histidine kinase C-terminal"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15478"
FT                   /db_xref="GOA:Q0VTN0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTN0"
FT                   /protein_id="CAL15478.1"
FT                   /translation="MMARSLRSRVLWLVALSLLSVWLLLALWLHNTVKQHLGTALDQRL
FT                   AASARMVASMANASAPVLSGNPGLQAAVNSGLFCQVMNVRGEILARSGGAPTAHLASAQ
FT                   DGFTERSLEGERWRVYTVSEGQIRVATAEPMAVRESLLSTLAWALLVGLLLALLGAWLA
FT                   VRWAVSRGLAPLDAMRKEFESRPVQTKSGVASSAAGITELMPLVTALDGWADQARQALL
FT                   RERRLTDDLAHELRTPLAALKTQLQVARLKMAPDAPAMMALTAAENASSRMADNLQQLL
FT                   ALARLDGLPQSRPRLVRKVIDESLAQLAGHPQRQAVQRDDQACAGITLAAPSLASLALR
FT                   NLLENALRYTPKGKEVWIRVVANTRELHIHVEDQGPGISDNQAVVCARGHRGDRGQTGL
FT                   GLAIVATVMARSGGQLTLHNRAGGGLCATLSWPLTDTA"
     atgatggcac gctcattacg ttcccgggtg ctgtggctgg tggcgctcag cttgctgagt        60
     gtctggttgc tgttggcatt gtggttacac aataccgtca agcagcatct gggaacggca       120
     ctggatcaac gtctggcagc gtcggcacgc atggtcgctt ccatggccaa tgccagtgca       180
     ccggtgttat ccggtaaccc tgggttgcag gccgcggtga atagcgggtt attttgtcag       240
     gtgatgaatg tacggggcga aattttggca cgctccggtg gagccccaac ggctcacctt       300
     gccagtgctc aggacggctt tacggaacga tccctggagg gtgagcgctg gcgcgtgtat       360
     accgtcagcg aagggcaaat acgggtggcg acagcggaac ccatggcggt gcgtgaatcc       420
     ctgttgtcga ccctagcctg ggcgttgctg gtaggcctgt tgctggcact attgggcgcc       480
     tggttggcgg tgcgctgggc tgtgagccgt ggcttggcac ccttggatgc gatgcgcaag       540
     gaatttgagt cacggcccgt gcagacaaaa tccggggtgg cgtccagcgc ggcggggata       600
     actgaactga tgccattggt aaccgcgctg gatggttggg ccgaccaggc ccggcaggca       660
     ttgttgcgcg aacgccgcct aaccgatgat ctagcccatg agctgcgtac gccgctggca       720
     gcactgaaaa cccagttaca agttgcccgc ttaaaaatgg ctccagatgc accagccatg       780
     atggcattga cggcagcgga gaacgccagt tcaaggatgg cggataacct gcaacagttg       840
     ctggccttgg cccgcctaga cggactacca cagagtcggc cgcgcctagt gagaaaggtg       900
     atcgatgaaa gtttggccca gctggccgga cacccgcagc ggcaagccgt gcagcgtgat       960
     gaccaagcgt gtgccgggat aacactggca gccccctccc tggccagcct ggcattacgc      1020
     aacttgctgg agaatgcgtt gcgttacaca ccaaagggca aggaagtgtg gattcgcgta      1080
     gtggcgaata cccgtgagct gcacatccat gtggaggacc aaggtccagg aatcagtgac      1140
     aatcaagcgg tggtttgcgc gcggggccac cgcggggacc gagggcaaac gggtctaggc      1200
     ctagccattg tagccaccgt gatggcccgc agcggcgggc agcttactct gcacaatcgc      1260
     gcgggcgggg ggctttgtgc caccttgagt tggccgctta cggatactgc ttga            1314
//

If you have problems or comments...

PBIL Back to PBIL home page