(data stored in ACNUC7421 zone)

EMBL: AM286690.PE300

AM286690.PE300       Location/Qualifiers
FT   CDS_pept        complement(327151..328380)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15748"
FT                   /db_xref="GOA:Q0VSV0"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSV0"
FT                   /protein_id="CAL15748.1"
FT                   /translation="MSDSQFDVVVFGASSFVGQILCQYLFDTYGANGELKWAAAGRSQN
FT                   KLKRVKASLGDGASTLPLIIANANDADSLDALCAQTRVVVSTVGPYALYGEPMIKACVN
FT                   SGTDYCDLTGEAQWIAEMLEKYETTAKKNGARIVHCCGFDSIPSDMGVYFLQQQSQARF
FT                   NAPASTVHMRVKVAKGGVSGGTVASMMNIAEEAGKDPALRKKLADPYLLCPPDHGFKSR
FT                   QNSIGLASYDNDFNAWVGPFVMDAINSRVVHRSNALSGKAYSDHFIYSEAMLTGNDMGG
FT                   RMKALGIGVGTGLFFVAAAVKPTRWVLNTFVMPQPGEGPSPEAQKAGFYDIRFVGHTDN
FT                   SETLKVKVTGDADPGYGSTAKLLGQAAACLAQDVAEDAPGGFWTTATLLGEPLLKRLQD
FT                   NAGMTFTVID"
     atgagcgatt cacaatttga tgtggtggtc ttcggtgcct ccagcttcgt tggccagatt        60
     ctctgccaat acctctttga cacctacggg gccaatggtg aattgaagtg ggcagccgcc       120
     ggacgctcgc agaacaagct gaaacgagta aaagcctctc tcggcgacgg cgccagcacc       180
     ctccccttga tcatcgccaa tgccaacgac gccgacagcc tagacgccct ctgcgcgcaa       240
     actcgcgtag tggtttcaac ggtggggccc tacgccttgt atggcgagcc catgatcaag       300
     gcctgtgtca acagcggtac tgattactgc gacctcacag gggaagccca gtggatagcg       360
     gaaatgctag aaaaatacga aaccaccgcc aagaaaaatg gcgcacgtat cgtgcactgc       420
     tgcggattcg attccattcc ctctgacatg ggggtctact ttctccaaca gcaatctcaa       480
     gcgcgcttta acgcccccgc cagcactgtg cacatgcggg taaaggtcgc caagggtggt       540
     gtatccggcg gcaccgtcgc tagcatgatg aatattgcag aagaagcagg caaagacccg       600
     gctctgcgca agaaattggc cgacccgtac ctgctctgcc ctccggacca cggcttcaag       660
     agccgccaga acagcatcgg actggccagt tacgataacg atttcaacgc ctgggttggc       720
     ccttttgtga tggatgccat taacagccgc gtggtgcatc gctccaacgc cttgagtggc       780
     aaggcctact ccgatcactt catctatagc gaggccatgc tcactggcaa tgacatgggc       840
     gggcgcatga aagcactggg tatcggcgtc ggcaccggcc tgttctttgt cgccgccgcg       900
     gtcaagccca cccgctgggt gctaaacaca tttgtaatgc cgcaacccgg cgaggggccc       960
     agcccagaag cacaaaaagc cggcttctat gacatccgtt ttgttggcca caccgacaac      1020
     agcgaaaccc tgaaagtaaa agtcaccggc gatgcggacc ccggttacgg ctccacggcc      1080
     aaactgcttg ggcaagccgc cgcctgcctg gcacaagacg tggcagaaga cgcccccggc      1140
     ggcttctgga caacagccac tctgcttggc gagcccttac tgaaacgact acaggataat      1200
     gccggcatga ccttcaccgt catcgactga                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page