(data stored in ACNUC7421 zone)

EMBL: AM286690.PE303

AM286690.PE303       Location/Qualifiers
FT   CDS_pept        complement(330883..332382)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15751"
FT                   /db_xref="InterPro:IPR041223"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSU7"
FT                   /protein_id="CAL15751.1"
FT                   /translation="MKYMAYSLSFKENALTSVRILSTHKAWKPWGMRITNPISKSGFFW
FT                   LPSTPDHKIPGEITISNGGKVEIETIGHFRNSPTQLAQILAGNHDGEARIHGHVQEFGD
FT                   VTVDDCIYTNQTLSTLGGTTLSARNAYLGALISEKEPPLFDSVDFSFDGLNEWARQTSL
FT                   SQSRSEDRNEISITYKKPENIDLRIGEGVSLHIIYDYSSSGSPGTRTLKSTTSLRLSFE
FT                   EATNIEEAIRLIHRIQNFFSFAMDETTHLLQINGTHEKYIIQHANNRETLKPIKIFYHG
FT                   AYDPGTESPSILAPSMLFHLRLVKETLEKNLTEWLRYYEVITPTLNLYFSQKSGAYRFL
FT                   NGRFLALAQAIETLHRNTSNEKFMDEAAFKDIRRQIITGCPEAFRGRLSPMLIHGNELS
FT                   LKERLERVIDPHSKYFGGNENVETLIKMIKDNRNYLTHYDRALENKLLDGPKLYAVCLK
FT                   IEAILQIKFMELIGFEESLLDQIIERSHAIANKLRPTLTDS"
     ttgaaataca tggcttattc tttatctttc aaagaaaacg cactgacaag tgtccgaatc        60
     ttgtccaccc acaaagcatg gaagccttgg ggcatgagaa tcacaaaccc tatttcaaaa       120
     tcaggctttt tctggctccc ctccacccca gatcacaaaa tccctgggga aattaccatt       180
     tcgaacggcg gcaaagtcga aattgagacc attggacact tcaggaactc gcccacacag       240
     ctagcgcaaa ttttggctgg aaaccatgac ggggaggcgc gcatacatgg ccatgtccaa       300
     gagtttgggg atgtaacagt tgatgactgt atatatacca accaaacact ctcaactctg       360
     ggagggacta ccctctcagc tagaaacgcc tatctaggtg ccctcatcag tgaaaaagaa       420
     ccaccactat tcgatagcgt cgacttctca tttgatggac tgaatgaatg ggcaaggcaa       480
     acatcgctgt cgcaaagccg aagcgaagat cgaaatgaaa tttcaattac gtataagaag       540
     ccagaaaaca ttgatctgcg cattggtgag ggagtatcac ttcatattat ctacgactat       600
     tcttcttctg gatctcctgg aactcgaaca ttaaagtcaa caacctcact ccgactctcc       660
     tttgaagaag ccacaaatat agaagaggca attcgtctca ttcatcgcat ccaaaacttt       720
     ttcagcttcg caatggacga gacaacacac ctacttcaga taaacggaac acatgagaaa       780
     tatataatcc aacatgccaa caatagagaa actctaaaac cgataaagat tttctaccat       840
     ggagcctatg accccggcac agaatcaccg tcaattcttg ctccgagcat gctgttccat       900
     cttcgcctag tcaaagaaac actagaaaaa aacctaacgg aatggcttcg ttactatgaa       960
     gtcataacac caacactgaa cctctatttc agccaaaaat ccggagctta ccgatttcta      1020
     aacggaaggt tccttgctct tgctcaagca atcgagacac tccacagaaa cacatctaat      1080
     gaaaagttta tggatgaggc cgcattcaaa gatatacggc gacagataat cacaggctgc      1140
     ccagaggctt ttagaggtcg gctaagcccg atgctgattc atgggaacga actaagccta      1200
     aaagagcgac tagaaagagt aatagaccca cactcaaaat actttggcgg caatgaaaac      1260
     gtcgaaaccc tgataaaaat gataaaagac aacagaaact atctaaccca ctacgataga      1320
     gcattagaaa ataaattatt ggatggaccg aaactatatg ctgtttgtct gaagattgag      1380
     gccatacttc aaataaaatt catggaactt atcggctttg aagaaagcct tctagaccaa      1440
     atcatagaaa gaagccacgc catagcaaac aagttaagac ccaccttaac tgacagttga      1500
//

If you have problems or comments...

PBIL Back to PBIL home page