(data stored in ACNUC7421 zone)

EMBL: AM286690.PE311

AM286690.PE311       Location/Qualifiers
FT   CDS_pept        complement(338834..339361)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15759"
FT                   /db_xref="GOA:Q0VST9"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VST9"
FT                   /protein_id="CAL15759.1"
FT                   /translation="MTGETPSNPYQTPDSITQKPNNPGAPELASRLYRFLGAIIDGLVQ
FT                   MVIIGPIIYFSGIWDAMMQSSGTISLTTSIGLFIAGELIFLALQGWLLFNRQQTIGKAL
FT                   LDMRIVGMEQDSVPAGKLYGLRYFVFHVLAQLPGINLIMLIDPLLIFRSDRRCLHDHLA
FT                   GTQVIQTQRTTT"
     atgaccggcg aaaccccaag caatccttac cagactccgg acagcataac ccagaagcca        60
     aacaaccccg gagcccctga actggccagc cgactgtatc gctttctcgg cgcaatcatt       120
     gatggcctag tgcaaatggt cattatcggc ccaatcatct atttcagcgg gatctgggac       180
     gccatgatgc aaagcagcgg cactatcagc ttgaccacca gcatcggcct gttcatcgcc       240
     ggggagctga tcttcctagc cctgcaaggc tggctactct ttaaccgcca gcaaaccatt       300
     ggcaaagccc ttctcgacat gcgtatcgtc ggcatggaac aggacagcgt tcccgccggc       360
     aaactctacg ggctacgtta ttttgttttc cacgtgctcg cccagctgcc cggcatcaac       420
     ctgatcatgc ttatcgaccc gttattgatt ttccgctcag accgccgctg cctgcacgac       480
     cacctcgccg gcacccaagt gattcaaacc caaagaacga ccacctaa                    528
//

If you have problems or comments...

PBIL Back to PBIL home page