(data stored in ACNUC7421 zone)

EMBL: AM286690.PE327

AM286690.PE327       Location/Qualifiers
FT   CDS_pept        358171..358716
FT                   /transl_table=11
FT                   /locus_tag="ABO_0327"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15775"
FT                   /db_xref="GOA:Q0VSS3"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSS3"
FT                   /protein_id="CAL15775.1"
FT                   /translation="MGGGSAVVAGNAAITVHPRAHFLFVPAERFMSKRTEQLTELLAPV
FT                   VEDLGFVLWGVEYIQGRGAVLRVFIDHADGISVDDCAAVSHEVSGVLDVEDPIPGEFNL
FT                   EVSSPGMDRPMFDITQYVDYIGEDVQLKLLAPVSGKRKMTAAIVAVDGDTLVVELDGET
FT                   LRVPYSQVDRARLQPRFN"
     atgggcggtg gatccgcggt cgttgcaggg aatgctgcaa ttactgttca tcctcgggcc        60
     cattttttgt ttgtaccggc ggaaagattt atgtcaaaac gcacagaaca attaaccgag       120
     ctgctggctc cggtagtgga agatctgggt ttcgtgcttt ggggtgtgga atacatccag       180
     gggcgcgggg ctgttctgcg tgtgtttatt gaccatgcag atggtatttc ggtagatgat       240
     tgcgcggccg tgagtcatga agtgagcggc gtgctggatg tggaagatcc aatccccggt       300
     gagtttaatc ttgaagtgtc ctcgccaggg atggatcggc ccatgttcga cattacgcag       360
     tatgtcgatt atatcggtga agatgtgcaa cttaagcttc tggcaccggt aagcggcaag       420
     cgtaaaatga cggcggccat tgtggccgtg gatggcgata cgctggtggt ggagctggat       480
     ggcgaaacct tgcgtgttcc ttacagtcag gtagatcgtg ctcggttgca gccccgcttc       540
     aattga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page