(data stored in ACNUC7421 zone)

EMBL: AM286690.PE343

AM286690.PE343       Location/Qualifiers
FT   CDS_pept        complement(379704..379880)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0343"
FT                   /product="conserved hypothetical protein"
FT                   /function="unknown"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15791"
FT                   /db_xref="GOA:Q0VSQ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSQ7"
FT                   /protein_id="CAL15791.1"
FT                   /translation="MYTDRLLIIFILGTYLLSPAIIEWWSEGGRAWYRPYLIWLGLIAL
FT                   SYWIAKIKDADGL"
     atgtatactg atcgcctgct tattattttt attctcggca cctacctgct atctccagcc        60
     atcattgaat ggtggagcga aggtgggcgt gcttggtatc gcccctacct aatctggcta       120
     ggccttattg ccttgagtta ctggattgcc aagattaagg atgccgatgg tctatag          177
//

If you have problems or comments...

PBIL Back to PBIL home page