(data stored in ACNUC7421 zone)

EMBL: AM286690.PE348

AM286690.PE348       Location/Qualifiers
FT   CDS_pept        complement(384361..385326)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to PFAM protein family
FT                   HMMPF01636"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15796"
FT                   /db_xref="GOA:Q0VSQ2"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSQ2"
FT                   /inference="protein motif:HMMPFAM:HMMPF01636"
FT                   /protein_id="CAL15796.1"
FT                   /translation="MSHPFDNLTPDYMLDAVDAAGFLSDGRLLQLNSFENRVYQVGQEE
FT                   GPPVIVKFYRPQRWSDEQILEEHAFSLFLAERDLPVVAPIEKGGTSLFHCDDFSFAVFR
FT                   RAGGHAPELANDDHLEQLGRTLARWHACGSDRPYTMRPTLQIVDDIRTASTFLCDDVVD
FT                   LNYRGQYRDVTGQILEKVAQQLNESAFPLLNVHGDCHTGNILWRPNADNQGGPHFVDLD
FT                   DSLRAPAMQDIWMLLSGDNDEQQHQLRVLARGYDTFLPFPWNQTRLIEPLRLRRIINYD
FT                   AWLAKRWDDPAFPPAFPWFESMNYWGNQVTLLQQQLQDLP"
     atgtctcatc ccttcgataa cctaaccccc gattacatgc tggatgccgt agatgccgcc        60
     ggcttcctca gcgacggccg cctgctgcaa ctgaacagtt ttgaaaaccg ggtgtatcag       120
     gtgggacagg aagagggccc tccggtgatt gtaaagtttt accgtccaca gcgctggagc       180
     gatgaacaaa ttctcgaaga acatgccttt agtttgttct tggcggaacg ggatttgcca       240
     gtggtagccc ccatagagaa gggtggcacc agcctgttcc actgcgatga tttttctttt       300
     gcggtctttc gccgcgctgg cggccacgca ccggaactgg ccaacgacga tcacttggag       360
     caactgggtc gcaccttggc ccgctggcat gcctgcggca gtgaccgccc ctacacgatg       420
     cgtcccaccc tgcagatcgt cgacgacatc cgtaccgcca gcaccttcct ttgcgacgac       480
     gtagtggacc tgaactaccg cggccaatat cgggacgtaa ccggccagat actggaaaag       540
     gtggcgcaac aattaaacga aagtgcgttc ccgctactga acgtgcatgg cgactgccac       600
     accggcaaca tcctctggcg gcccaacgcc gacaatcagg gcggccccca ctttgtggat       660
     ctggacgaca gcctacgagc ccctgccatg caagacatct ggatgctgct ctccggcgat       720
     aacgatgagc agcagcacca actacgggtc cttgctcgcg gctacgacac tttcctgccg       780
     ttcccctgga atcagacacg cctaatcgag ccgctgcgtc ttcgccgcat tatcaactac       840
     gacgcatggc tggccaaacg ctgggacgac ccggcctttc cccccgcctt cccgtggttc       900
     gaatcgatga actactgggg taatcaagtg accctgttgc agcagcaact acaggacctc       960
     ccctaa                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page