(data stored in ACNUC7421 zone)

EMBL: AM286690.PE352

AM286690.PE352       Location/Qualifiers
FT   CDS_pept        389467..389928
FT                   /transl_table=11
FT                   /locus_tag="ABO_0352"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15800"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSP8"
FT                   /protein_id="CAL15800.1"
FT                   /translation="MLFFHRLVRLCLLSVVMAGCAVKPVMHEPQQPMSASQELEGSPAL
FT                   SLLASAEQARQQGNSSRAERYLERALNIAPDSSWLYKELADLRLTEGDARGAEGFALKA
FT                   LRLAPEHPEYQAGLWELVATARDRQGDAGGAKAARERAAVLREPKPLEA"
     atgttgtttt ttcacaggct tgttcgattg tgtctgctga gtgtggtgat ggcagggtgt        60
     gcggtgaagc ccgttatgca cgagccgcag caaccaatga gcgctagcca agaactggag       120
     ggctccccgg cactgagctt gttagccagt gcggaacagg cgaggcagca aggaaacagc       180
     tctcgggcag aacggtatct ggagcgagcg ctgaatatcg cccctgactc atcttggcta       240
     tacaaggagt tggcggactt gcggctcact gagggtgatg ctcgcggggc agaaggtttt       300
     gctcttaaag cactgcggtt agcgccggag catccggagt atcaagccgg gttgtgggag       360
     ttggtggcga ccgcgcggga tcgacagggc gatgcgggcg gagcgaaagc ggctcgggag       420
     cgtgcggcgg tattgcgcga accgaaaccg cttgaggcat ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page